(data stored in ACNUC7421 zone)

EMBL: CP001630.PE262

CP001630.PE262       Location/Qualifiers
FT   CDS             290017..290466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0267"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: bam:Bamb_3888
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34236"
FT                   /db_xref="GOA:C6WFA4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA4"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACU34236.1"
FT                   /translation="MRTDLDAVDWALVDALQADARLSYNELARKVGVSPPTVAQRVRRL
FT                   ENAGVITGYRAVVDPTAVGRSVIALVRMKCYGPRCITVHPELLDDCPEVVEVVRLTGDI
FT                   CSVVKVVTTSVSELERLLVRLGGHGETSSAMVLSTPIPWRPLTAG"
     MRTDLDAVDW ALVDALQADA RLSYNELARK VGVSPPTVAQ RVRRLENAGV ITGYRAVVDP        60
     TAVGRSVIAL VRMKCYGPRC ITVHPELLDD CPEVVEVVRL TGDICSVVKV VTTSVSELER       120
     LLVRLGGHGE TSSAMVLSTP IPWRPLTAG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page