(data stored in ACNUC7421 zone)

EMBL: CP001630.PE263

CP001630.PE263       Location/Qualifiers
FT   CDS             complement(290435..291361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0268"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; KEGG:
FT                   spe:Spro_3661 N-acetylmuramic acid-6- phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34237"
FT                   /db_xref="GOA:C6WFA5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA5"
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /protein_id="ACU34237.1"
FT                   /translation="MTARGDVVRVESPTEARNPRTGEIDRMSTLDVLRMINSEDRGVPD
FT                   AVAAVLPELARAADLAVAALRGGGRVHYVGAGTSGRLATLDAAELPPTFNTPPDWFVAH
FT                   HAGGAEALVRAVENAEDQAATGAERIRAHAEPGDLVLGVTASGRTPFVLGALAAAHELG
FT                   ARTALVSNNPSAPPVPVDVLITVDTGPEAIAGSTRMKAGSSQKLVLTAFSTAVMVRMGR
FT                   TYSNLMVSVRATNAKLRGRTVRILSEATGLDERECTDALTAAGDDLKVALVHLLSGSPA
FT                   PDAAEALTATGGHVRQALTRLSAGATG"
     MTARGDVVRV ESPTEARNPR TGEIDRMSTL DVLRMINSED RGVPDAVAAV LPELARAADL        60
     AVAALRGGGR VHYVGAGTSG RLATLDAAEL PPTFNTPPDW FVAHHAGGAE ALVRAVENAE       120
     DQAATGAERI RAHAEPGDLV LGVTASGRTP FVLGALAAAH ELGARTALVS NNPSAPPVPV       180
     DVLITVDTGP EAIAGSTRMK AGSSQKLVLT AFSTAVMVRM GRTYSNLMVS VRATNAKLRG       240
     RTVRILSEAT GLDERECTDA LTAAGDDLKV ALVHLLSGSP APDAAEALTA TGGHVRQALT       300
     RLSAGATG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page