(data stored in ACNUC7421 zone)

EMBL: CP001630.PE264

CP001630.PE264       Location/Qualifiers
FT   CDS             complement(291358..292272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0269"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: reh:H16_B1066 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34238"
FT                   /db_xref="GOA:C6WFA6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA6"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACU34238.1"
FT                   /translation="MSTENTDASPLVKIRSLLPGLARAEQRVAKVVLDNPATVAHRSIT
FT                   EVAESAGTSETTVTRFCKAIGVGGYPELRIALAADTARTAARTDRDLGGDIGPGDDLRQ
FT                   VVGKVAFADARAVEETAEQLNVDTLQAVVDAVARAGRVDVYGFGASAFVAFDLQQKLHR
FT                   IGRTCFAWNDTHIALTSAAVLTGADVAVGISHTGSTTETVEALRVARERGATTVALTNF
FT                   PRSPISEVADHVLTTAARETTFRSGAMASRIAQLTVVDCLFIGVAQHHVESATSALEAT
FT                   YDAVAGHRLGARPDGRRRREAGR"
     MSTENTDASP LVKIRSLLPG LARAEQRVAK VVLDNPATVA HRSITEVAES AGTSETTVTR        60
     FCKAIGVGGY PELRIALAAD TARTAARTDR DLGGDIGPGD DLRQVVGKVA FADARAVEET       120
     AEQLNVDTLQ AVVDAVARAG RVDVYGFGAS AFVAFDLQQK LHRIGRTCFA WNDTHIALTS       180
     AAVLTGADVA VGISHTGSTT ETVEALRVAR ERGATTVALT NFPRSPISEV ADHVLTTAAR       240
     ETTFRSGAMA SRIAQLTVVD CLFIGVAQHH VESATSALEA TYDAVAGHRL GARPDGRRRR       300
     EAGR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page