(data stored in ACNUC7421 zone)

EMBL: CP001630.PE265

CP001630.PE265       Location/Qualifiers
FT   CDS             complement(292383..294536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0270"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34239"
FT                   /db_xref="GOA:C6WFA7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA7"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU34239.1"
FT                   /translation="MRLPTRPATAAPHPAARLRTTDADTSTSTSTATTNTGTSTSTGTG
FT                   TSTGTGTGTGTGTAVLRLPARLGASITRLLAGLGKSVPQAFVRLGGSITRLPDRLSTTV
FT                   LRLPDRLGVVVVWLRGLLGGSAARRGGSSTAVVLRPLGWPGAGMARLRGLLGGSAARRA
FT                   GSLGTIGLRLSALLGATALLLGTLAPVSAETVPRARFDQPWAGFAPVGTVLRAGAPERV
FT                   GVDPVPVERALGVVRGYTVGAAPLFPGAVTLMAHDGVVVGHEAVGWAVRYADGVSELPV
FT                   GERVPTALDTIFDLASISKLFTSIVVVRQAELGRVGIERPVAEYLPEFGVAGKGDITVR
FT                   QLLTHTSGLAAWLPLWSGWPDRDSRIKAVMDVAPARAPGTGYLYSDLNLITLGVLVERV
FT                   SGMPLDALVRETITEPLGLVDTGYNPPPEKLGRIAATEFQTSPPRGIVRGSVHDENAWS
FT                   LGGVAGHAGVFSTARELAVLGQAILNGGAYRGKRILSEESVTGMLTNLTPEFPGNSHGL
FT                   GFELDTRWYMGALSAPRTAGHTGFTGTTMVLDPASRSIALLLTNRVHPSRDRGSINPAR
FT                   RAVASGLAEALAVGPVRGRSAWRGDPGGTLTTKPLPDGPKVLRFSAFTDLDAGESVAVQ
FT                   EFDGSGWRDLRVLTGAGTRTWERVELPMTGTAARWVRSGVGANGARGGYVDAIEVVAGR
FT                   RVLLDGERGTGEVTASGWRAVDR"
     MRLPTRPATA APHPAARLRT TDADTSTSTS TATTNTGTST STGTGTSTGT GTGTGTGTAV        60
     LRLPARLGAS ITRLLAGLGK SVPQAFVRLG GSITRLPDRL STTVLRLPDR LGVVVVWLRG       120
     LLGGSAARRG GSSTAVVLRP LGWPGAGMAR LRGLLGGSAA RRAGSLGTIG LRLSALLGAT       180
     ALLLGTLAPV SAETVPRARF DQPWAGFAPV GTVLRAGAPE RVGVDPVPVE RALGVVRGYT       240
     VGAAPLFPGA VTLMAHDGVV VGHEAVGWAV RYADGVSELP VGERVPTALD TIFDLASISK       300
     LFTSIVVVRQ AELGRVGIER PVAEYLPEFG VAGKGDITVR QLLTHTSGLA AWLPLWSGWP       360
     DRDSRIKAVM DVAPARAPGT GYLYSDLNLI TLGVLVERVS GMPLDALVRE TITEPLGLVD       420
     TGYNPPPEKL GRIAATEFQT SPPRGIVRGS VHDENAWSLG GVAGHAGVFS TARELAVLGQ       480
     AILNGGAYRG KRILSEESVT GMLTNLTPEF PGNSHGLGFE LDTRWYMGAL SAPRTAGHTG       540
     FTGTTMVLDP ASRSIALLLT NRVHPSRDRG SINPARRAVA SGLAEALAVG PVRGRSAWRG       600
     DPGGTLTTKP LPDGPKVLRF SAFTDLDAGE SVAVQEFDGS GWRDLRVLTG AGTRTWERVE       660
     LPMTGTAARW VRSGVGANGA RGGYVDAIEV VAGRRVLLDG ERGTGEVTAS GWRAVDR          717
//

If you have problems or comments...

PBIL Back to PBIL home page