(data stored in ACNUC7421 zone)

EMBL: CP001630.PE266

CP001630.PE266       Location/Qualifiers
FT   CDS             complement(294549..295880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34240"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA8"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ACU34240.1"
FT                   /translation="MERRRFLAAGAVGVGTAVFGGAASSGAGAEPGGAGAGGAGGFGPG
FT                   GVGPEDVGQGGTDQNAVVRTGAEQLAGRGWRELAGRRVGVLTNPTGVLVDQTHVVDSMV
FT                   AAGVSPVAVFGPEHGFRGTAQAGGSEGDYLDPRTNIPVYDAYGADATKLAGLLTKAGVE
FT                   HVVFDIADIGARFYTYIWSMYTAMQAAARVGARFTVLDRPNPVGGEAHGPQLDPAYATG
FT                   VGRKPIVQQHGMTVGELAGFFNAEFLPSDGGAVVDLRVVEVRGWRRSRLDTGLPWVPPS
FT                   PNVPTRDTALVYPGTCLFEGLVFSEGRGTTRPFETIGAPGLDWRWAEDLNARGLPGVRF
FT                   REAHFTPWFGKFANTACSGVALQVTDPGRFDAIRTAVEMIVVARSRYPAVFAWRPDNWI
FT                   DKLSGSDRLRRMVGAGAGADEVVGAWSAELSTFRTRRRRHLRYR"
     MERRRFLAAG AVGVGTAVFG GAASSGAGAE PGGAGAGGAG GFGPGGVGPE DVGQGGTDQN        60
     AVVRTGAEQL AGRGWRELAG RRVGVLTNPT GVLVDQTHVV DSMVAAGVSP VAVFGPEHGF       120
     RGTAQAGGSE GDYLDPRTNI PVYDAYGADA TKLAGLLTKA GVEHVVFDIA DIGARFYTYI       180
     WSMYTAMQAA ARVGARFTVL DRPNPVGGEA HGPQLDPAYA TGVGRKPIVQ QHGMTVGELA       240
     GFFNAEFLPS DGGAVVDLRV VEVRGWRRSR LDTGLPWVPP SPNVPTRDTA LVYPGTCLFE       300
     GLVFSEGRGT TRPFETIGAP GLDWRWAEDL NARGLPGVRF REAHFTPWFG KFANTACSGV       360
     ALQVTDPGRF DAIRTAVEMI VVARSRYPAV FAWRPDNWID KLSGSDRLRR MVGAGAGADE       420
     VVGAWSAELS TFRTRRRRHL RYR                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page