(data stored in ACNUC7421 zone)

EMBL: CP001630.PE268

CP001630.PE268       Location/Qualifiers
FT   CDS             complement(296355..298097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0273"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bha:BH0675 beta-hexosamidase A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34242"
FT                   /db_xref="GOA:C6WFB0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB0"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACU34242.1"
FT                   /translation="MHRLSRTLLTAAVVASSTAALPSAHAARPEPPAPQSVTSLVRGMS
FT                   LEEKVGQLFVTYVHGQSADEVHPGNLRDFGVDTPAQVVTRYRPGGVIYFNNSSYDNIDT
FT                   PAQIAALSNGLQQASRVPLTISTDQEMGIVTRIGPPLTQFPGSMALGAGRDERAAERAA
FT                   SVTARELRALGITQNFAPDADVNSNPANPVIGVRSFSSDPDLAATMVAAQVRGYQQRHL
FT                   SRTAVSAAAKHFPGHGDTADDSHTSLPTVDRTVEQWREVDAKPFRAAIAAGVDSIMTAH
FT                   IRMPAIDPSGEPATLSKPVVTGLLREELGYDGVVITDSLAMAGVRQLHTDAEIPVLALK
FT                   AGVDQLLMPVKLGEAIDAVVAAVRAGELSERRIDQSVLRVLRMKFLRGALPVWPVPPNP
FT                   VVGTPDRLAQAQEVADRAVTVVRDDAGVVRAGRVSGSVLVTGWGETTTAALAERLRARG
FT                   ATPQVVVTGSAPNEQQIAGAVSAAGGVGAVVVLTNALSRQPAQRALVDRLVASGKPVVA
FT                   VAVQNPYDVAHSNAQAWLATYSYGAVAMESVARVLSGEVRPVGRLPVDVPGPVAYPLGH
FT                   GLSW"
     MHRLSRTLLT AAVVASSTAA LPSAHAARPE PPAPQSVTSL VRGMSLEEKV GQLFVTYVHG        60
     QSADEVHPGN LRDFGVDTPA QVVTRYRPGG VIYFNNSSYD NIDTPAQIAA LSNGLQQASR       120
     VPLTISTDQE MGIVTRIGPP LTQFPGSMAL GAGRDERAAE RAASVTAREL RALGITQNFA       180
     PDADVNSNPA NPVIGVRSFS SDPDLAATMV AAQVRGYQQR HLSRTAVSAA AKHFPGHGDT       240
     ADDSHTSLPT VDRTVEQWRE VDAKPFRAAI AAGVDSIMTA HIRMPAIDPS GEPATLSKPV       300
     VTGLLREELG YDGVVITDSL AMAGVRQLHT DAEIPVLALK AGVDQLLMPV KLGEAIDAVV       360
     AAVRAGELSE RRIDQSVLRV LRMKFLRGAL PVWPVPPNPV VGTPDRLAQA QEVADRAVTV       420
     VRDDAGVVRA GRVSGSVLVT GWGETTTAAL AERLRARGAT PQVVVTGSAP NEQQIAGAVS       480
     AAGGVGAVVV LTNALSRQPA QRALVDRLVA SGKPVVAVAV QNPYDVAHSN AQAWLATYSY       540
     GAVAMESVAR VLSGEVRPVG RLPVDVPGPV AYPLGHGLSW                             580
//

If you have problems or comments...

PBIL Back to PBIL home page