(data stored in ACNUC7421 zone)

EMBL: CP001630.PE269

CP001630.PE269       Location/Qualifiers
FT   CDS             complement(298682..299494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0274"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); KEGG: pap:PSPA7_0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34243"
FT                   /db_xref="GOA:C6WFB1"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB1"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACU34243.1"
FT                   /translation="MTDPAAEGTRVAAFFDLDKTVIAKSSTLAFSRPFFQEGLINRRAV
FT                   LKSAYAQFVFMLAGADDDQMDRMRSHITALCSGWDVEQVRSIVEETLHDIVDPLVYKEA
FT                   TQLISDHKAQGHDVVVVSASGEELVSPIAQMVGADLSVGTRMVTSSGRYSGEVDFYCAG
FT                   ENKAVMVKQLAAERGYDLERCHAYSDSVSDLPLLEAVGHPTAVNPDRGLRKAATQRGWP
FT                   VLAFTDPVSLRARISRPSGAAVAVTAIGLGATVAAGAAWYGLRRRRRS"
     MTDPAAEGTR VAAFFDLDKT VIAKSSTLAF SRPFFQEGLI NRRAVLKSAY AQFVFMLAGA        60
     DDDQMDRMRS HITALCSGWD VEQVRSIVEE TLHDIVDPLV YKEATQLISD HKAQGHDVVV       120
     VSASGEELVS PIAQMVGADL SVGTRMVTSS GRYSGEVDFY CAGENKAVMV KQLAAERGYD       180
     LERCHAYSDS VSDLPLLEAV GHPTAVNPDR GLRKAATQRG WPVLAFTDPV SLRARISRPS       240
     GAAVAVTAIG LGATVAAGAA WYGLRRRRRS                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page