(data stored in ACNUC7421 zone)

EMBL: CP001630.PE27

CP001630.PE27        Location/Qualifiers
FT   CDS             complement(29891..31153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0027"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: eba:ebA2155 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34001"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI0"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU34001.1"
FT                   /translation="MGLVQRFERRLEGMVGDTFARVFGGNVVSQEVAQALQREADGNIR
FT                   ELAGGRLLAPNHYVVLLGPEDHDRLAGDGQDELRITKSLGDSIQEHLEESGWDTYGDVV
FT                   VSLERSDALHTGQFRTRSSVDPDVKVDSRRSAPPRTAGDGSMSQPPGYGQGQGQPGYDP
FT                   YAQGGYGGQQPGYDQQGYGQGGQQQGYGQGQQGYDQQGYGQGGQQPGYDQGYGQGGQPG
FT                   YGQGQQGYDQGYGQGGYGGQQPGYDQQGYAGGQQPGYGQGQQGYDQGYGQGGAGYDQGG
FT                   QAGYGQQAAGYDQAGYGQQAAGYDQGYGQQAGYGGAPAGGAQRQLSATLHLDDGSNRTY
FT                   NLKQGGNVVGRGQEADFRLPDTGVSRRHLEITWDGHSAMLADLGSTNGTTVNGTPVQTW
FT                   QLAEGDVVRIGHSSLVFRTQG"
     MGLVQRFERR LEGMVGDTFA RVFGGNVVSQ EVAQALQREA DGNIRELAGG RLLAPNHYVV        60
     LLGPEDHDRL AGDGQDELRI TKSLGDSIQE HLEESGWDTY GDVVVSLERS DALHTGQFRT       120
     RSSVDPDVKV DSRRSAPPRT AGDGSMSQPP GYGQGQGQPG YDPYAQGGYG GQQPGYDQQG       180
     YGQGGQQQGY GQGQQGYDQQ GYGQGGQQPG YDQGYGQGGQ PGYGQGQQGY DQGYGQGGYG       240
     GQQPGYDQQG YAGGQQPGYG QGQQGYDQGY GQGGAGYDQG GQAGYGQQAA GYDQAGYGQQ       300
     AAGYDQGYGQ QAGYGGAPAG GAQRQLSATL HLDDGSNRTY NLKQGGNVVG RGQEADFRLP       360
     DTGVSRRHLE ITWDGHSAML ADLGSTNGTT VNGTPVQTWQ LAEGDVVRIG HSSLVFRTQG       420
//

If you have problems or comments...

PBIL Back to PBIL home page