(data stored in ACNUC7421 zone)

EMBL: CP001630.PE270

CP001630.PE270       Location/Qualifiers
FT   CDS             299900..301015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2914 Flp pilus assembly protein
FT                   ATPase CpaE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34244"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34244.1"
FT                   /translation="MVIMRPLCPRSPGTTVLHVGFDESGERDVGRSVVLVDGAELLDEV
FT                   LRLAAVAECELERVVDVTALRGRWHDAPVVLLDERAVVACAEAGLPRRPGVLLVSTGPP
FT                   GELTWPRAVELGVERAVSADAGLVALLRDATEVAPEAGRVLAVLGGRGGAGASVLAAAV
FT                   ARAVAASGGPSLLVDCDPLGGGLDLALGAETSAGMRWSDLDLSGRVPAAALRQVLPACG
FT                   GVRVLSCGRDGEGPGAGAVASVVEAGRRSGQVVVCDLPRQRTPAADAALDRADLAVLVV
FT                   PAEVRACAAARGVARRLAERGARTRALVRVRASGGLSAQEVAAAVGVPLLTRMRGQRQL
FT                   ASALDRGRFPTSTRGPLAKAATTVLEVLRAG"
     MVIMRPLCPR SPGTTVLHVG FDESGERDVG RSVVLVDGAE LLDEVLRLAA VAECELERVV        60
     DVTALRGRWH DAPVVLLDER AVVACAEAGL PRRPGVLLVS TGPPGELTWP RAVELGVERA       120
     VSADAGLVAL LRDATEVAPE AGRVLAVLGG RGGAGASVLA AAVARAVAAS GGPSLLVDCD       180
     PLGGGLDLAL GAETSAGMRW SDLDLSGRVP AAALRQVLPA CGGVRVLSCG RDGEGPGAGA       240
     VASVVEAGRR SGQVVVCDLP RQRTPAADAA LDRADLAVLV VPAEVRACAA ARGVARRLAE       300
     RGARTRALVR VRASGGLSAQ EVAAAVGVPL LTRMRGQRQL ASALDRGRFP TSTRGPLAKA       360
     ATTVLEVLRA G                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page