(data stored in ACNUC7421 zone)

EMBL: CP001630.PE271

CP001630.PE271       Location/Qualifiers
FT   CDS             301321..302439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0276"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bav:BAV2285 pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34245"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB3"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACU34245.1"
FT                   /translation="MGADLVERVRRRLAEGRAELTPSAVAAAVRGEAGGVLGDEEVLRA
FT                   MSELGREFAGAGLLEPLLRAPGTTDVLVTAPDQVWVDGEDGLRRADVVFPDERAVRRLA
FT                   QRLAVAAGRRLDEAVPHVDGWLPGAVRLHAVLPPITRNTCLSLRVLRPATHDLAELRAR
FT                   GAFSAEVAEALRALVRSRTAFLVVGGTGSGKTTLLAALLGCVPHDQRVVCVEDAGELEP
FT                   DHPQVVRLVARAANVEGAGEVTVRDLVRQALRMRPDRIVVGEVRGAEVCDLLSALNTGH
FT                   EGGAGTLHANSPAEVPARLEALAALGGLDRVALHSQVLAALRAVLHVRRTPEGRRLVEI
FT                   GVFERAAGDLRVVPVWRHDTGWRNRALLESSR"
     MGADLVERVR RRLAEGRAEL TPSAVAAAVR GEAGGVLGDE EVLRAMSELG REFAGAGLLE        60
     PLLRAPGTTD VLVTAPDQVW VDGEDGLRRA DVVFPDERAV RRLAQRLAVA AGRRLDEAVP       120
     HVDGWLPGAV RLHAVLPPIT RNTCLSLRVL RPATHDLAEL RARGAFSAEV AEALRALVRS       180
     RTAFLVVGGT GSGKTTLLAA LLGCVPHDQR VVCVEDAGEL EPDHPQVVRL VARAANVEGA       240
     GEVTVRDLVR QALRMRPDRI VVGEVRGAEV CDLLSALNTG HEGGAGTLHA NSPAEVPARL       300
     EALAALGGLD RVALHSQVLA ALRAVLHVRR TPEGRRLVEI GVFERAAGDL RVVPVWRHDT       360
     GWRNRALLES SR                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page