(data stored in ACNUC7421 zone)

EMBL: CP001630.PE272

CP001630.PE272       Location/Qualifiers
FT   CDS             302579..303334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0277"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   acp:A2cp1_3010 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34246"
FT                   /db_xref="GOA:C6WFB4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB4"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU34246.1"
FT                   /translation="MSLLLFAAAVLLLPSTARGRLEALRGKRKPRVTFRPTTPLVVGAG
FT                   ALLGLLLGPAGAVSGAVLAAVLWRAHRVRAAHRADLLAADALAEGLRSFTTELRTGAHP
FT                   AGAALAAARDAAEPAATVLTAIATSTSRGGDVVSALAGTPAARLARAWRLADHHGVPLA
FT                   EVLDTARADLERRTAFTRTVHARMAGPRTSAAVLAALPVLGVLLGQLSGTSPLSILRDT
FT                   LPGQALLLVGVLLLVVGLRWSAGLTGSAA"
     MSLLLFAAAV LLLPSTARGR LEALRGKRKP RVTFRPTTPL VVGAGALLGL LLGPAGAVSG        60
     AVLAAVLWRA HRVRAAHRAD LLAADALAEG LRSFTTELRT GAHPAGAALA AARDAAEPAA       120
     TVLTAIATST SRGGDVVSAL AGTPAARLAR AWRLADHHGV PLAEVLDTAR ADLERRTAFT       180
     RTVHARMAGP RTSAAVLAAL PVLGVLLGQL SGTSPLSILR DTLPGQALLL VGVLLLVVGL       240
     RWSAGLTGSA A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page