(data stored in ACNUC7421 zone)

EMBL: CP001630.PE273

CP001630.PE273       Location/Qualifiers
FT   CDS             303331..303888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0278"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG: Hcn2;
FT                   hyperpolarization activated cyclic nucleotide-gated
FT                   potassium channel 2; K04955 hyperpolarization activated
FT                   cyclic nucleotide-gated potassium channel 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34247"
FT                   /db_xref="GOA:C6WFB5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB5"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU34247.1"
FT                   /translation="MSFLLLALAVLILPGGRSPCARLRPPVQPIAKPRRAKRSPPDPLA
FT                   LAETWDLFAAALRSGLPVPSALHAVLPGTPPGPAERLGQVRDLLALGADPATAWDPALD
FT                   HPATAPLARSARRTARSGAALADQVADLAARLRASAADDAESRAQRAAVLVAGPLSLCF
FT                   LPAFLCLGVAPVLIGIASGLNR"
     MSFLLLALAV LILPGGRSPC ARLRPPVQPI AKPRRAKRSP PDPLALAETW DLFAAALRSG        60
     LPVPSALHAV LPGTPPGPAE RLGQVRDLLA LGADPATAWD PALDHPATAP LARSARRTAR       120
     SGAALADQVA DLAARLRASA ADDAESRAQR AAVLVAGPLS LCFLPAFLCL GVAPVLIGIA       180
     SGLNR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page