(data stored in ACNUC7421 zone)

EMBL: CP001630.PE276

CP001630.PE276       Location/Qualifiers
FT   CDS             304605..304934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_2535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34250"
FT                   /db_xref="GOA:C6WFB8"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34250.1"
FT                   /translation="MRLGDRGSASVLGAVLVVVLVSLAVLGVQFGAAVVVRHRVVAAAD
FT                   LAALAAAGRLLEGDGVACGWAERVVREMGAVLERCSVREWEVAVSVSGPANLFGTPVGR
FT                   ARAGP"
     MRLGDRGSAS VLGAVLVVVL VSLAVLGVQF GAAVVVRHRV VAAADLAALA AAGRLLEGDG        60
     VACGWAERVV REMGAVLERC SVREWEVAVS VSGPANLFGT PVGRARAGP                   109
//

If you have problems or comments...

PBIL Back to PBIL home page