(data stored in ACNUC7421 zone)

EMBL: CP001630.PE277

CP001630.PE277       Location/Qualifiers
FT   CDS             305305..305910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0282"
FT                   /product="Bifunctional DNA primase/polymerase"
FT                   /note="PFAM: Bifunctional DNA primase/polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34251"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB9"
FT                   /inference="protein motif:PFAM:PF09250"
FT                   /protein_id="ACU34251.1"
FT                   /translation="MEWSESWRGAFRIELRAEAVNLAWHGWPVLPGTYPSGDGWLGRDQ
FT                   VEASGPVPVHADWRERIGTLPEQVATWWTGGSYTILLATGHGVDAVEVNAELGKRAAVA
FT                   LRTAGAPAPIVATPDGRWMFLVRSGGVVREDLAARGVVHRTRGEHITLPPSPARHGVVH
FT                   WRVKPQVCGWQLPEPGTVLDAIGSALAVRHDGLVALES"
     MEWSESWRGA FRIELRAEAV NLAWHGWPVL PGTYPSGDGW LGRDQVEASG PVPVHADWRE        60
     RIGTLPEQVA TWWTGGSYTI LLATGHGVDA VEVNAELGKR AAVALRTAGA PAPIVATPDG       120
     RWMFLVRSGG VVREDLAARG VVHRTRGEHI TLPPSPARHG VVHWRVKPQV CGWQLPEPGT       180
     VLDAIGSALA VRHDGLVALE S                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page