(data stored in ACNUC7421 zone)

EMBL: CP001630.PE278

CP001630.PE278       Location/Qualifiers
FT   CDS             complement(306276..308699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0283"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: dvu:DVU0256 DEAD-box ATP
FT                   dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34252"
FT                   /db_xref="GOA:C6WFC0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC0"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACU34252.1"
FT                   /translation="MANQGRRLLDRVLAGVPLGEAPLTHAEELPGQDAREVPWPSWAAP
FT                   EVVSALVERGVPAPWSHQAQAAELAWSGRDVVVATGTASGKSLAYQLPVLSALVAEGRA
FT                   TALYLSPTKALGADQIRAVEELAVPGVRAASFDGDTAMDERDWVRAHANWVFSNPDMLH
FT                   RGVLPNHARWIRFFRGLAYVVVDECHAYRGVFGSHVALLLRRLRRVARRYGADPVFVLA
FT                   SATVAEPAASAERLVGKPCAAVVEDGSPRAGRVVALWEPPLLSELEGENGAPVRRSAGA
FT                   ETARILADLVVEGARSLAFVRSRVGAELTAMGARRVLAEVDPELPGRVAAYRGGYLPEE
FT                   RRALERALASGDLLGVATTNALELGVDIAGLDAVVVAGFPGTLASFWQQAGRAGRSGGD
FT                   SLVVFVARDDPLDTYLAHHPEAVLRRPVEATVLDPSNPYVLAPHLACAAAELPLTEECL
FT                   AGFGEGAREVVDGLVADRVLRRRPNGGWYWTARERPQGQVDIRGSGGEQVVVVEGDTGR
FT                   VLGTVDPAAAHWTVHEGAVYLHQGESYVVDSLDLEAGIALVRAERPDWSTTARDTKDIV
FT                   VVRVEQERRFAGVRVCLGEVEVTSQVVSYLRKLPSGQVVDQVPLDLPAQVLRTRAVWYA
FT                   VDDSLLGSAPGGAGLAPATVPGALHAAEHAAIGLLPLFATCDRWDIGGVSTALHQDTGE
FT                   ATVFVHDGHPGGAGFADRGFAAVVPWLAAAREAISSCACPAGCPSCVQSPKCGNGNDPL
FT                   DKAGGAAVLDVVLRAVENPPSDAQPDRLGGSGGAGGSGAGGSGSGLAGEAGTAR"
     MANQGRRLLD RVLAGVPLGE APLTHAEELP GQDAREVPWP SWAAPEVVSA LVERGVPAPW        60
     SHQAQAAELA WSGRDVVVAT GTASGKSLAY QLPVLSALVA EGRATALYLS PTKALGADQI       120
     RAVEELAVPG VRAASFDGDT AMDERDWVRA HANWVFSNPD MLHRGVLPNH ARWIRFFRGL       180
     AYVVVDECHA YRGVFGSHVA LLLRRLRRVA RRYGADPVFV LASATVAEPA ASAERLVGKP       240
     CAAVVEDGSP RAGRVVALWE PPLLSELEGE NGAPVRRSAG AETARILADL VVEGARSLAF       300
     VRSRVGAELT AMGARRVLAE VDPELPGRVA AYRGGYLPEE RRALERALAS GDLLGVATTN       360
     ALELGVDIAG LDAVVVAGFP GTLASFWQQA GRAGRSGGDS LVVFVARDDP LDTYLAHHPE       420
     AVLRRPVEAT VLDPSNPYVL APHLACAAAE LPLTEECLAG FGEGAREVVD GLVADRVLRR       480
     RPNGGWYWTA RERPQGQVDI RGSGGEQVVV VEGDTGRVLG TVDPAAAHWT VHEGAVYLHQ       540
     GESYVVDSLD LEAGIALVRA ERPDWSTTAR DTKDIVVVRV EQERRFAGVR VCLGEVEVTS       600
     QVVSYLRKLP SGQVVDQVPL DLPAQVLRTR AVWYAVDDSL LGSAPGGAGL APATVPGALH       660
     AAEHAAIGLL PLFATCDRWD IGGVSTALHQ DTGEATVFVH DGHPGGAGFA DRGFAAVVPW       720
     LAAAREAISS CACPAGCPSC VQSPKCGNGN DPLDKAGGAA VLDVVLRAVE NPPSDAQPDR       780
     LGGSGGAGGS GAGGSGSGLA GEAGTAR                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page