(data stored in ACNUC7421 zone)

EMBL: CP001630.PE279

CP001630.PE279       Location/Qualifiers
FT   CDS             308935..311295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0284"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: xcb:XC_0853 membrane-bound proton-
FT                   translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34253"
FT                   /db_xref="GOA:C6WFC1"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC1"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACU34253.1"
FT                   /translation="MSRQFLAEGIELSGGDRGLVAAVAVVALAALVVGAVLLKEVLAAG
FT                   QGTAKMQDIAKAVQEGASAYLNRQFRTLGIFVVVVFALLFLLPAEDTGERIGRSLFFIV
FT                   GAVFSATIGYLGMWLSTRANVRVAAAAQAGQSGREKAMRVAFRTGGVVGMFTVGLGLFG
FT                   AAVVVLVYAGQAPRVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQNIPEDD
FT                   PRNAATIADNVGDNVGDCAGMAADLFESYAVTLVASLILGTAAFGSQGLLFPLIVPAIG
FT                   VVTAVIGVYITGARPGESGLSAINRSFYISAVISAVLCTAAAFAFLPGTFAELGGVSAE
FT                   IAATEGNPAVIAAAAVLIGIVLAGVILWLTGYYTGTEHKPVQEVGRTSLTGAATVILSG
FT                   ISLGFESAVYTALVIGGAVYGAFLLSGSVIVALFAVALAGCGLLTTVGVIVAMDTFGPV
FT                   SDNAQGIAEMSGDVDGEGAQVLTELDAVGNTTKAITKGIAIATAVLAAAALFGSYKDAI
FT                   EKALVEVGGVFEAQDFVAFTPNVLVGLVIGAAVVFMFSGLAVNAVTRAAGAIVFEVRRQ
FT                   FRDNPGIMDGTTKPEYGRVVDICTRDSLRELATPGLLAVMAPIAVGFGLGVGPLAGYLA
FT                   GAIATGTLMAVFLANSGGAWDNAKKLVEDGHHGGKGSDAHAATVIGDTVGDPFKDTAGP
FT                   AINPLIKVMNLVSVLIAPAVVTFSVGADASAPVRYGIAVFAVGVVVAAVVVSKRRGTVI
FT                   GDEPADPPSGSPSVPAQATVTDPVQARATGGTA"
     MSRQFLAEGI ELSGGDRGLV AAVAVVALAA LVVGAVLLKE VLAAGQGTAK MQDIAKAVQE        60
     GASAYLNRQF RTLGIFVVVV FALLFLLPAE DTGERIGRSL FFIVGAVFSA TIGYLGMWLS       120
     TRANVRVAAA AQAGQSGREK AMRVAFRTGG VVGMFTVGLG LFGAAVVVLV YAGQAPRVLE       180
     GFGFGAALLA MFMRVGGGIF TKAADVGADL VGKVEQNIPE DDPRNAATIA DNVGDNVGDC       240
     AGMAADLFES YAVTLVASLI LGTAAFGSQG LLFPLIVPAI GVVTAVIGVY ITGARPGESG       300
     LSAINRSFYI SAVISAVLCT AAAFAFLPGT FAELGGVSAE IAATEGNPAV IAAAAVLIGI       360
     VLAGVILWLT GYYTGTEHKP VQEVGRTSLT GAATVILSGI SLGFESAVYT ALVIGGAVYG       420
     AFLLSGSVIV ALFAVALAGC GLLTTVGVIV AMDTFGPVSD NAQGIAEMSG DVDGEGAQVL       480
     TELDAVGNTT KAITKGIAIA TAVLAAAALF GSYKDAIEKA LVEVGGVFEA QDFVAFTPNV       540
     LVGLVIGAAV VFMFSGLAVN AVTRAAGAIV FEVRRQFRDN PGIMDGTTKP EYGRVVDICT       600
     RDSLRELATP GLLAVMAPIA VGFGLGVGPL AGYLAGAIAT GTLMAVFLAN SGGAWDNAKK       660
     LVEDGHHGGK GSDAHAATVI GDTVGDPFKD TAGPAINPLI KVMNLVSVLI APAVVTFSVG       720
     ADASAPVRYG IAVFAVGVVV AAVVVSKRRG TVIGDEPADP PSGSPSVPAQ ATVTDPVQAR       780
     ATGGTA                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page