(data stored in ACNUC7421 zone)

EMBL: CP001630.PE28

CP001630.PE28        Location/Qualifiers
FT   CDS             31797..32417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34002"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34002.1"
FT                   /translation="MSSTPARIEVTDSAKAKATSAAAVPIPELPGSVEELATVAAVRLG
FT                   WHGVVLPEMVLMGRKVVVVADLIADAHAERLCLGAAPEVDRATVSTWVWPEMDGRVPPA
FT                   AVRIVGVLAVARHWRTALASAVPFARFGNAAAVLPASVALSHDYLANCLPRVRRYGVNV
FT                   LLADESSELTTDVCGRNETVPVEDTATTRWVNELVYERVLATA"
     MSSTPARIEV TDSAKAKATS AAAVPIPELP GSVEELATVA AVRLGWHGVV LPEMVLMGRK        60
     VVVVADLIAD AHAERLCLGA APEVDRATVS TWVWPEMDGR VPPAAVRIVG VLAVARHWRT       120
     ALASAVPFAR FGNAAAVLPA SVALSHDYLA NCLPRVRRYG VNVLLADESS ELTTDVCGRN       180
     ETVPVEDTAT TRWVNELVYE RVLATA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page