(data stored in ACNUC7421 zone)

EMBL: CP001630.PE280

CP001630.PE280       Location/Qualifiers
FT   CDS             311416..312054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34254"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34254.1"
FT                   /translation="MRARLVTAVAASALSACLLAGCTGQDSEPTPTTSSTSTSASPEQL
FT                   AADYLDKVCSATSAFATVQKTPPGADVTDPGKRKELMAVYMGQFGEAFTRSATELRAVG
FT                   ESPVAGGDQVVEKMAATFSEMATVFTDAKSAVEQADANDQYGGLAPARDALAKLADFSV
FT                   PLKEVESTPELAAAARKAPKCQALRTATPSPSATAGAPAVESSVPPSTS"
     MRARLVTAVA ASALSACLLA GCTGQDSEPT PTTSSTSTSA SPEQLAADYL DKVCSATSAF        60
     ATVQKTPPGA DVTDPGKRKE LMAVYMGQFG EAFTRSATEL RAVGESPVAG GDQVVEKMAA       120
     TFSEMATVFT DAKSAVEQAD ANDQYGGLAP ARDALAKLAD FSVPLKEVES TPELAAAARK       180
     APKCQALRTA TPSPSATAGA PAVESSVPPS TS                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page