(data stored in ACNUC7421 zone)

EMBL: CP001630.PE283

CP001630.PE283       Location/Qualifiers
FT   CDS             313088..313771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0D24365p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34257"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34257.1"
FT                   /translation="MKFRVSLVGAALASAAVLSACSSGTAGTASPAGDAPATSSSASPA
FT                   PSGSASAVPTSASAKAGGGDNAKAVSWAGELCATFTGMVDRSLVMLEDVSSEMEKGNLD
FT                   GYRSAVLDYLAGTGTAMSGSLKRLNELGAPTASSAALHAEMVKFLEGVGAESGAAAKKM
FT                   RGLAVTDPAFVEQMGALDQGQGGSDVLLKHLENAEKDPELDLAFATAESCQEMESKLGQ
FT                   MPGSG"
     MKFRVSLVGA ALASAAVLSA CSSGTAGTAS PAGDAPATSS SASPAPSGSA SAVPTSASAK        60
     AGGGDNAKAV SWAGELCATF TGMVDRSLVM LEDVSSEMEK GNLDGYRSAV LDYLAGTGTA       120
     MSGSLKRLNE LGAPTASSAA LHAEMVKFLE GVGAESGAAA KKMRGLAVTD PAFVEQMGAL       180
     DQGQGGSDVL LKHLENAEKD PELDLAFATA ESCQEMESKL GQMPGSG                     227
//

If you have problems or comments...

PBIL Back to PBIL home page