(data stored in ACNUC7421 zone)

EMBL: CP001630.PE284

CP001630.PE284       Location/Qualifiers
FT   CDS             313913..314566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34258"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34258.1"
FT                   /translation="MKRHLSVTSVLLSATLALAACDTNTDGAAPASSPAAASAAPASAQ
FT                   VDDGEREARWAASFCTTLGSRAKAAVELMQKMFAQAAEAGENVSEADMQAMQKDLLVEF
FT                   MEDGAKESLDAAKQLEGIGAPAVVGEEFHQKFITLLKTSGDEAAAAVEKVKALDPTSPT
FT                   FEAELDKLSEGGAAETLVAPLQEVGKSKPELNEVLKRTPECVDVVKQMSAIAGK"
     MKRHLSVTSV LLSATLALAA CDTNTDGAAP ASSPAAASAA PASAQVDDGE REARWAASFC        60
     TTLGSRAKAA VELMQKMFAQ AAEAGENVSE ADMQAMQKDL LVEFMEDGAK ESLDAAKQLE       120
     GIGAPAVVGE EFHQKFITLL KTSGDEAAAA VEKVKALDPT SPTFEAELDK LSEGGAAETL       180
     VAPLQEVGKS KPELNEVLKR TPECVDVVKQ MSAIAGK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page