(data stored in ACNUC7421 zone)

EMBL: CP001630.PE285

CP001630.PE285       Location/Qualifiers
FT   CDS             314696..315328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_0780 branched-chain alpha-keto acid
FT                   dehydrogenase E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34259.1"
FT                   /translation="MGQQLSFYSAEARRPGVDDLAGLLCGPGRVLGFARGRAARLTAVL
FT                   ADPWRGPALVAALAERGVQAESGAPEPVGDPEPPADGQEPGAQPPVQVRTPFRTDLAPL
FT                   AAHWLLAGAKVVPRGFTPHGGVLRLWALTSGRWVEPGYLLGLDPDAPDTHEPLRAALAS
FT                   AGLPAALLTPKSGGPALRVTGRRRLERLSELVGRAPTGVGDRTWPAA"
     MGQQLSFYSA EARRPGVDDL AGLLCGPGRV LGFARGRAAR LTAVLADPWR GPALVAALAE        60
     RGVQAESGAP EPVGDPEPPA DGQEPGAQPP VQVRTPFRTD LAPLAAHWLL AGAKVVPRGF       120
     TPHGGVLRLW ALTSGRWVEP GYLLGLDPDA PDTHEPLRAA LASAGLPAAL LTPKSGGPAL       180
     RVTGRRRLER LSELVGRAPT GVGDRTWPAA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page