(data stored in ACNUC7421 zone)

EMBL: CP001630.PE286

CP001630.PE286       Location/Qualifiers
FT   CDS             315457..318228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0291"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bba:Bd0964 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34260"
FT                   /db_xref="GOA:C6WFC8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC8"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACU34260.1"
FT                   /translation="MAGSTRTRKSTGGSAGGNRRLVIVESPTKARKIASYLGNGFVVES
FT                   SKGHIRDLPRGAADVPAKYKGQPWARLGVDVDHDFEPLYIVTPDKKSTVAELKELLKGV
FT                   DELYLATDGDREGEAIAWHLLETLKPSVPVRRMVFHEITEPAILAAAASPRDLDLSLVD
FT                   AQETRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRIVVERERERMKFVTASFWDV
FT                   SATIDAGAEATPRQFAGRLVSVDGTRLATGRDFGSDGRLKDGVEVKVLDEAHARAIAEG
FT                   LTGAAMRVASVEEKPYTRKPYPPFMTSTIQQEAGRKLRFSADRTMRAAQKLYENGYITY
FT                   MRTDSTALSETAITAARAQATDLYGAQYVAKEPRQYTRKVKNAQEAHEAIRPAGEVFRT
FT                   PGQVARELDSDEYKLYELIWQRTIASQMADARGNTTSVRVAGRTGGGEDVLFASSGRTI
FT                   TFAGFLKAYVETVDSEAGGNADDAESRLPQLVAEQPVSAAELSADGHSTSPPPRFTEPS
FT                   LIKTMEDLGIGRPSTYASIISTIQDRGYVWKKGSALVPSWVAFAVVGLLEQHFGRLVDY
FT                   DFTAALEDELDGIAEGRQERTTWLSGFYFGGDVGPESSIGRSGGLKKLVGSSVEEIDAR
FT                   EINSIPLFSDEGGHTVVVRVGRYGPYLEREVDGASQRANLPDDLPPDELSLEIAEKLFA
FT                   TPQEGRSLGNDPATGHEIVAKEGRFGPYVTEVLPEPAEGKKAGKPRTSSLFKSMSLDTV
FT                   TLEDALRLLSLPRVVGADPESGAEITAQNGRYGPYLKRGTDSRSLTSEDQLFTVTLDEA
FT                   LKIYAEPKKRGRAAAAPPLKELGNDPVSGKPMVVKEGRFGPYVTDGETNASLRKSDNVE
FT                   TLSDERGSELLAEKRAKGPSTKKKPAARTTKAAAKPAAKKPAAKKTPAKSKG"
     MAGSTRTRKS TGGSAGGNRR LVIVESPTKA RKIASYLGNG FVVESSKGHI RDLPRGAADV        60
     PAKYKGQPWA RLGVDVDHDF EPLYIVTPDK KSTVAELKEL LKGVDELYLA TDGDREGEAI       120
     AWHLLETLKP SVPVRRMVFH EITEPAILAA AASPRDLDLS LVDAQETRRI LDRLYGYEVS       180
     PVLWKKVMPK LSAGRVQSVA TRIVVERERE RMKFVTASFW DVSATIDAGA EATPRQFAGR       240
     LVSVDGTRLA TGRDFGSDGR LKDGVEVKVL DEAHARAIAE GLTGAAMRVA SVEEKPYTRK       300
     PYPPFMTSTI QQEAGRKLRF SADRTMRAAQ KLYENGYITY MRTDSTALSE TAITAARAQA       360
     TDLYGAQYVA KEPRQYTRKV KNAQEAHEAI RPAGEVFRTP GQVARELDSD EYKLYELIWQ       420
     RTIASQMADA RGNTTSVRVA GRTGGGEDVL FASSGRTITF AGFLKAYVET VDSEAGGNAD       480
     DAESRLPQLV AEQPVSAAEL SADGHSTSPP PRFTEPSLIK TMEDLGIGRP STYASIISTI       540
     QDRGYVWKKG SALVPSWVAF AVVGLLEQHF GRLVDYDFTA ALEDELDGIA EGRQERTTWL       600
     SGFYFGGDVG PESSIGRSGG LKKLVGSSVE EIDAREINSI PLFSDEGGHT VVVRVGRYGP       660
     YLEREVDGAS QRANLPDDLP PDELSLEIAE KLFATPQEGR SLGNDPATGH EIVAKEGRFG       720
     PYVTEVLPEP AEGKKAGKPR TSSLFKSMSL DTVTLEDALR LLSLPRVVGA DPESGAEITA       780
     QNGRYGPYLK RGTDSRSLTS EDQLFTVTLD EALKIYAEPK KRGRAAAAPP LKELGNDPVS       840
     GKPMVVKEGR FGPYVTDGET NASLRKSDNV ETLSDERGSE LLAEKRAKGP STKKKPAART       900
     TKAAAKPAAK KPAAKKTPAK SKG                                               923
//

If you have problems or comments...

PBIL Back to PBIL home page