(data stored in ACNUC7421 zone)

EMBL: CP001630.PE287

CP001630.PE287       Location/Qualifiers
FT   CDS             318252..318821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34261"
FT                   /db_xref="GOA:C6WFC9"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34261.1"
FT                   /translation="MDGGLFGPDGTQAPPPPAAFPDPLAGLVTGELPWALPAPEVRAAE
FT                   VRAAAPLAPPAAVTPQRAARPTGAGGRPQAGRARTGQRAPQAPRPAVPHPPVPYPPASY
FT                   PPVPHPTAPYPQVPHPQLQHPAPPRRQVPGLRAQRGPAAPAQPAEALAKGTGSTVVGIL
FT                   VVLGVIASILFTTLREVVGELLDLLR"
     MDGGLFGPDG TQAPPPPAAF PDPLAGLVTG ELPWALPAPE VRAAEVRAAA PLAPPAAVTP        60
     QRAARPTGAG GRPQAGRART GQRAPQAPRP AVPHPPVPYP PASYPPVPHP TAPYPQVPHP       120
     QLQHPAPPRR QVPGLRAQRG PAAPAQPAEA LAKGTGSTVV GILVVLGVIA SILFTTLREV       180
     VGELLDLLR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page