(data stored in ACNUC7421 zone)

EMBL: CP001630.PE288

CP001630.PE288       Location/Qualifiers
FT   CDS             318901..321033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0293"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1;
FT                   thymidylate kinase; KEGG: eli:ELI_06215 thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34262"
FT                   /db_xref="GOA:C6WFD0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFD0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34262.1"
FT                   /translation="MSTIQDSDTAGGPGRSGSNRTEASTGHRIRSVLAIRPFRRLWGVT
FT                   YLCSVGDWLSLLALTGLVTKLAEGYRWEGFALSAVVITQLLPGMLFAPLGGVLADRFDR
FT                   RKVMVACDLARGALFLSIAFVGTAWWLFIANFLIGCCAMLWIPAKDSAVPNLLRRPDQV
FT                   ETANQLGLVMTYGITTISGFGLYALISGIPGYFHLQGGDLSFRIATIAVVVNGLLYVSS
FT                   AVLVATRIPELSGRMATPRKRDDDAPGFLVMMRDGLSYAWHRPLLRGLVIGMTGAFAAA
FT                   GAVIGSAKLYALSLLGGESAYGLLFIAVFAGLATGMITAPKLARRLTHGRLFGVTIVCA
FT                   GLSLGVVSLAPHLWFALVAVALVGGCAGIAFLTGLTIIGSKVEDEVRGRMVALVQSLMK
FT                   VILGLSTVASPLLVTTLQPRVITVLDHPLKIDGTRPVLFGAGVLAAAVGLIAYRLMDDR
FT                   RETPILSDLLAALRGRPRRERGLLITVEGDASLDTSVQARELAEVLRSAGHEVLLASEP
FT                   DLDERRVHELLNTADLAGVRAHALVAAAVRADVVERRVRPALEAGLIVVVDRFADSPIA
FT                   HFSASGSVDTSELERLSDWATGRLRPDLTVLLDRTPTTLPASALGAPPGAVPAGTAPPG
FT                   AASAGLEGARRTITHVEHHWQVQRLLTGMAAADPDRYLVVDADGTPDEVAARVKAAVAR
FT                   LVGGEIRAAAPLAETP"
     MSTIQDSDTA GGPGRSGSNR TEASTGHRIR SVLAIRPFRR LWGVTYLCSV GDWLSLLALT        60
     GLVTKLAEGY RWEGFALSAV VITQLLPGML FAPLGGVLAD RFDRRKVMVA CDLARGALFL       120
     SIAFVGTAWW LFIANFLIGC CAMLWIPAKD SAVPNLLRRP DQVETANQLG LVMTYGITTI       180
     SGFGLYALIS GIPGYFHLQG GDLSFRIATI AVVVNGLLYV SSAVLVATRI PELSGRMATP       240
     RKRDDDAPGF LVMMRDGLSY AWHRPLLRGL VIGMTGAFAA AGAVIGSAKL YALSLLGGES       300
     AYGLLFIAVF AGLATGMITA PKLARRLTHG RLFGVTIVCA GLSLGVVSLA PHLWFALVAV       360
     ALVGGCAGIA FLTGLTIIGS KVEDEVRGRM VALVQSLMKV ILGLSTVASP LLVTTLQPRV       420
     ITVLDHPLKI DGTRPVLFGA GVLAAAVGLI AYRLMDDRRE TPILSDLLAA LRGRPRRERG       480
     LLITVEGDAS LDTSVQAREL AEVLRSAGHE VLLASEPDLD ERRVHELLNT ADLAGVRAHA       540
     LVAAAVRADV VERRVRPALE AGLIVVVDRF ADSPIAHFSA SGSVDTSELE RLSDWATGRL       600
     RPDLTVLLDR TPTTLPASAL GAPPGAVPAG TAPPGAASAG LEGARRTITH VEHHWQVQRL       660
     LTGMAAADPD RYLVVDADGT PDEVAARVKA AVARLVGGEI RAAAPLAETP                  710
//

If you have problems or comments...

PBIL Back to PBIL home page