(data stored in ACNUC7421 zone)

EMBL: CP001630.PE289

CP001630.PE289       Location/Qualifiers
FT   CDS             321047..322246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0294"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dal:Dalk_0024 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34263"
FT                   /db_xref="GOA:C6WFD1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFD1"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACU34263.1"
FT                   /translation="MPRGVWSEVVGQPDAVTVLSAAAEAAAAIVAGGTPAPGAMTHAWL
FT                   FTGPPGSGRTEAARAFAGALQCTAADDRPGCGVCAGCHTALAGTHADVRVVAPEGLSIS
FT                   VNEMRALVQVSARRPTSGRWQVVIVADADRLTEGASNALLKAVEEPPDRTVFLLCAPSE
FT                   HPYDVSVTIRSRCRVVRLGSPKVPDVAAALEEEGVAPDLASWSASVTGGNVVRARRLAT
FT                   DEQSRLRRESVLAIPLALRRPADVFTCADDLVKAAEGDALSANEDRDEQERKALETAMG
FT                   AGGTGKGTASATRGAKGALKDLEKRQKSRATRTQRDSLDQALVDLAAFYRDVLVTATGS
FT                   EAALNHPDRAADARTAAAAWSRESTLRRLEAVLACRGALERNVKPRIAVEAMLTTLQRG
FT                   "
     MPRGVWSEVV GQPDAVTVLS AAAEAAAAIV AGGTPAPGAM THAWLFTGPP GSGRTEAARA        60
     FAGALQCTAA DDRPGCGVCA GCHTALAGTH ADVRVVAPEG LSISVNEMRA LVQVSARRPT       120
     SGRWQVVIVA DADRLTEGAS NALLKAVEEP PDRTVFLLCA PSEHPYDVSV TIRSRCRVVR       180
     LGSPKVPDVA AALEEEGVAP DLASWSASVT GGNVVRARRL ATDEQSRLRR ESVLAIPLAL       240
     RRPADVFTCA DDLVKAAEGD ALSANEDRDE QERKALETAM GAGGTGKGTA SATRGAKGAL       300
     KDLEKRQKSR ATRTQRDSLD QALVDLAAFY RDVLVTATGS EAALNHPDRA ADARTAAAAW       360
     SRESTLRRLE AVLACRGALE RNVKPRIAVE AMLTTLQRG                              399
//

If you have problems or comments...

PBIL Back to PBIL home page