(data stored in ACNUC7421 zone)

EMBL: CP001630.PE29

CP001630.PE29        Location/Qualifiers
FT   CDS             32468..33103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0029"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   xca:xccb100_0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34003"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACU34003.1"
FT                   /translation="MRLVIAGGHGKIALHVQRLLAAGGDAATALVRNEDHFADVTEAGG
FT                   VPVLCDLEASDVASVAEYLTGADAVLFAAGAGPGSGVGRKDSVDRGASALLADAAERAG
FT                   VRRFVQISSAGIGRTTGDEVFDAYLLAKGAAEEDLKARDLDWTIVRPGRLTDEPATGAV
FT                   RLTEGDAQDGSVPRADVAAVVVAVLAQPSSVGKTYELISGETPVQDAI"
     MRLVIAGGHG KIALHVQRLL AAGGDAATAL VRNEDHFADV TEAGGVPVLC DLEASDVASV        60
     AEYLTGADAV LFAAGAGPGS GVGRKDSVDR GASALLADAA ERAGVRRFVQ ISSAGIGRTT       120
     GDEVFDAYLL AKGAAEEDLK ARDLDWTIVR PGRLTDEPAT GAVRLTEGDA QDGSVPRADV       180
     AAVVVAVLAQ PSSVGKTYEL ISGETPVQDA I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page