(data stored in ACNUC7421 zone)

EMBL: CP001630.PE290

CP001630.PE290       Location/Qualifiers
FT   CDS             322756..323649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0295"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dal:Dalk_4823 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34264"
FT                   /db_xref="GOA:C6WGE8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGE8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34264.1"
FT                   /translation="MRRPDTTDAVVDVAPSRRTVRRPRSVSVVVTAHGLEPTAGVVVED
FT                   ALRGLEELGVPGEVVVVVGRADRTAQVALTAGASVVESRPGRGAAVLAGVAASRGDVVC
FT                   LLDGDVRYFGDPPLVPLLVEPILGGLADACVSDLYWRPPHPRLWLHGFFAPLIGRVYPE
FT                   LLPRAGSTPWSGQRAALRALWPAELPDGATADLALLLHWNREAALLRPVLADDWTAPGR
FT                   PRLEPSRADLDLVVADALAHGRIDETGAKALPDWFEAVQSGAGERWGDVVDPVDFAAAE
FT                   RDVLEEALRELRAHGL"
     MRRPDTTDAV VDVAPSRRTV RRPRSVSVVV TAHGLEPTAG VVVEDALRGL EELGVPGEVV        60
     VVVGRADRTA QVALTAGASV VESRPGRGAA VLAGVAASRG DVVCLLDGDV RYFGDPPLVP       120
     LLVEPILGGL ADACVSDLYW RPPHPRLWLH GFFAPLIGRV YPELLPRAGS TPWSGQRAAL       180
     RALWPAELPD GATADLALLL HWNREAALLR PVLADDWTAP GRPRLEPSRA DLDLVVADAL       240
     AHGRIDETGA KALPDWFEAV QSGAGERWGD VVDPVDFAAA ERDVLEEALR ELRAHGL          297
//

If you have problems or comments...

PBIL Back to PBIL home page