(data stored in ACNUC7421 zone)

EMBL: CP001630.PE291

CP001630.PE291       Location/Qualifiers
FT   CDS             complement(323703..325736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0296"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: bcb:BCB4264_A4637 iron compound ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34265"
FT                   /db_xref="GOA:C6WGE9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGE9"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34265.1"
FT                   /translation="MLRTAAVVAGAVAAIVLLSAVHLTQGTSDTGALDLLSAVLGDGNA
FT                   QAMAVLEGSRLPRLLTALLVGVALGVAGAGMQSIARNPLASPDTLAVNSGAHLAVVSFA
FT                   AFGIGLPAYAAGGAAFVGGLAATALVLALSGGASTSPRLVLVGSAVGLTLYSATTLVLL
FT                   LFEQETTGLYAWGSGSLSVGDLRTTSQMAPVVLVGVVGLVLMSRSLDVLALGDDNAAVV
FT                   GLKVRRTRLGAVLLTVALTAAAVTAAGPVGFVGLSAPVITRLLAARVPGLARHRALLPV
FT                   SGLVGVLVVLGADVLLRALLGASEAVRVPTGVMTTVLGASVLVWLARGQRSGGSRRQPP
FT                   SGRVGVVGSRRRLVAVSVVLAALVVAAPLVGLLMGDRVVLLGDLGNWVTGRTGPALTFV
FT                   LDQRLPRVLAAVVAGAALAVAGCGVQSVSRNPLAEPGLLGITAGAGLGAIGLITLVPGA
FT                   GPWQIAGAAGFGALVAFALVYGLSWRGGQDSDRLVIIGIALWSAGMSLITLLVATTDPW
FT                   NTVKALTWLSGSTYGRTLEQVLPPALALAAIGPLLWFAHRDLDLHSLDDDTPRVLGVPV
FT                   ERSRLLLLLGSGVLAASAVAAIGVVGFVGLVAPHLARSLVGGRNARVLPVAAGLGAVLV
FT                   SLADTIGRTVISPAQIPAGLVISLVGTPYFVLVLWRSRERRT"
     MLRTAAVVAG AVAAIVLLSA VHLTQGTSDT GALDLLSAVL GDGNAQAMAV LEGSRLPRLL        60
     TALLVGVALG VAGAGMQSIA RNPLASPDTL AVNSGAHLAV VSFAAFGIGL PAYAAGGAAF       120
     VGGLAATALV LALSGGASTS PRLVLVGSAV GLTLYSATTL VLLLFEQETT GLYAWGSGSL       180
     SVGDLRTTSQ MAPVVLVGVV GLVLMSRSLD VLALGDDNAA VVGLKVRRTR LGAVLLTVAL       240
     TAAAVTAAGP VGFVGLSAPV ITRLLAARVP GLARHRALLP VSGLVGVLVV LGADVLLRAL       300
     LGASEAVRVP TGVMTTVLGA SVLVWLARGQ RSGGSRRQPP SGRVGVVGSR RRLVAVSVVL       360
     AALVVAAPLV GLLMGDRVVL LGDLGNWVTG RTGPALTFVL DQRLPRVLAA VVAGAALAVA       420
     GCGVQSVSRN PLAEPGLLGI TAGAGLGAIG LITLVPGAGP WQIAGAAGFG ALVAFALVYG       480
     LSWRGGQDSD RLVIIGIALW SAGMSLITLL VATTDPWNTV KALTWLSGST YGRTLEQVLP       540
     PALALAAIGP LLWFAHRDLD LHSLDDDTPR VLGVPVERSR LLLLLGSGVL AASAVAAIGV       600
     VGFVGLVAPH LARSLVGGRN ARVLPVAAGL GAVLVSLADT IGRTVISPAQ IPAGLVISLV       660
     GTPYFVLVLW RSRERRT                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page