(data stored in ACNUC7421 zone)

EMBL: CP001630.PE292

CP001630.PE292       Location/Qualifiers
FT   CDS             complement(325736..326707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0297"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bcb:BCB4264_A4636 iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34266"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF0"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACU34266.1"
FT                   /translation="MRLLTPALLAAAVLLSACGTTESTSSEPSASGDAGGAITLTDARG
FT                   KTVELKAPAKKVVSLEWAETEMVLTLGVTPVGAADPEGYATWNAAEALPGDVKDVGKRG
FT                   EPSVDAIVALEPDLVLMPLARDTAVAEQLEKAVPVVMTKSSDATKNFDRLREDFTLIAK
FT                   AVGKEAEAKTALAEMDAKLAEGKKAVEAKGATGTPFVMADGWMQGSTVSIRPFGKGSLV
FT                   SDTAEAVGLVNAWTGEVDAEWGLGATDVEGMTAITDPKTIMVYSASEEDVFTTGLKDNA
FT                   VWQRLPFTASGKITKLEKGTWTFGGPKSVAVIADQFVKAATS"
     MRLLTPALLA AAVLLSACGT TESTSSEPSA SGDAGGAITL TDARGKTVEL KAPAKKVVSL        60
     EWAETEMVLT LGVTPVGAAD PEGYATWNAA EALPGDVKDV GKRGEPSVDA IVALEPDLVL       120
     MPLARDTAVA EQLEKAVPVV MTKSSDATKN FDRLREDFTL IAKAVGKEAE AKTALAEMDA       180
     KLAEGKKAVE AKGATGTPFV MADGWMQGST VSIRPFGKGS LVSDTAEAVG LVNAWTGEVD       240
     AEWGLGATDV EGMTAITDPK TIMVYSASEE DVFTTGLKDN AVWQRLPFTA SGKITKLEKG       300
     TWTFGGPKSV AVIADQFVKA ATS                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page