(data stored in ACNUC7421 zone)

EMBL: CP001630.PE293

CP001630.PE293       Location/Qualifiers
FT   CDS             complement(326738..327556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0298"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ent:Ent638_1120 iron-enterobactin transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34267"
FT                   /db_xref="GOA:C6WGF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34267.1"
FT                   /translation="MSQGDALLTGEALVLAHHDRAVVEGVSLELRAGEVTALVGPNGSG
FT                   KSTVLRSLARLHKPREGGVRLGERQVWGRAALSGKEFARNVTLLTQHRPTPSGVSVRDV
FT                   VSYGRHPHRAGWRGVDAGGAAAVERAMELTGVTPMAGRGVDELSGGELQRVWLASCLAQ
FT                   ETSVLLLDEPTNHLDLRYQVEVLDVVRDLADDHGVAVGVVLHDLDHAGVVADEVVLLCD
FT                   GRVVASGAVRDVLTADHLTSAYGVEVQVVDDPVTGAPHCRPLGKRTQRRP"
     MSQGDALLTG EALVLAHHDR AVVEGVSLEL RAGEVTALVG PNGSGKSTVL RSLARLHKPR        60
     EGGVRLGERQ VWGRAALSGK EFARNVTLLT QHRPTPSGVS VRDVVSYGRH PHRAGWRGVD       120
     AGGAAAVERA MELTGVTPMA GRGVDELSGG ELQRVWLASC LAQETSVLLL DEPTNHLDLR       180
     YQVEVLDVVR DLADDHGVAV GVVLHDLDHA GVVADEVVLL CDGRVVASGA VRDVLTADHL       240
     TSAYGVEVQV VDDPVTGAPH CRPLGKRTQR RP                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page