(data stored in ACNUC7421 zone)

EMBL: CP001630.PE295

CP001630.PE295       Location/Qualifiers
FT   CDS             complement(328149..329243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0300"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   swi:Swit_1615 coenzyme F420-dependent N5 N10- methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34269"
FT                   /db_xref="GOA:C6WGF3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019919"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF3"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34269.1"
FT                   /translation="MTPAVGSGVRGSSEPTAVLSPSPTSRPDPAADWTWPPHPRTTGPV
FT                   LVDQVEVEYTPTTVVEAARAAEEAGIDGFWVAETRHDPFVALGRVADRVERVGLGTAIA
FT                   VAFARNPMSTAVQANDLQLLSRGRFRLGLGSQVEQHITKRFGMPWSRPAARMREYVLAM
FT                   RAIWESWATGERPRFRGEFSTHTLMTPFFDPGPNPFGPPEVWLAGVGERMTEVAGEVAD
FT                   GFLCHAFTTERYLREVTLPALERGLAKSGRTLEGFGVSGPSMVVTDDASAAAVRRQIAF
FT                   YGSTPAYRPVLDLHGWGELHEELHRLSRRGLWAEMDAAVPDEVLGAFAVTGTPAEAAAE
FT                   VVARYGDVVTRIAAPVLRADLRSG"
     MTPAVGSGVR GSSEPTAVLS PSPTSRPDPA ADWTWPPHPR TTGPVLVDQV EVEYTPTTVV        60
     EAARAAEEAG IDGFWVAETR HDPFVALGRV ADRVERVGLG TAIAVAFARN PMSTAVQAND       120
     LQLLSRGRFR LGLGSQVEQH ITKRFGMPWS RPAARMREYV LAMRAIWESW ATGERPRFRG       180
     EFSTHTLMTP FFDPGPNPFG PPEVWLAGVG ERMTEVAGEV ADGFLCHAFT TERYLREVTL       240
     PALERGLAKS GRTLEGFGVS GPSMVVTDDA SAAAVRRQIA FYGSTPAYRP VLDLHGWGEL       300
     HEELHRLSRR GLWAEMDAAV PDEVLGAFAV TGTPAEAAAE VVARYGDVVT RIAAPVLRAD       360
     LRSG                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page