(data stored in ACNUC7421 zone)

EMBL: CP001630.PE296

CP001630.PE296       Location/Qualifiers
FT   CDS             complement(329240..329704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0301"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: GE20613 gene
FT                   product from transcript GE20613- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34270"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF4"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACU34270.1"
FT                   /translation="MRSESNTRLSAPAPGRGGKVVCGFLVVLTALVLAGCEGSAPAGGQ
FT                   VSTSPSPTTTTTSATTTTSSPAPVTTTSTTTTTTTPPPAVAPPPQPNPQPAPNPQPAPN
FT                   PQPAPEPKPAPSAYYKNCAEARAAGAAPLHAGEPGYRTGLDRDGDGVACE"
     MRSESNTRLS APAPGRGGKV VCGFLVVLTA LVLAGCEGSA PAGGQVSTSP SPTTTTTSAT        60
     TTTSSPAPVT TTSTTTTTTT PPPAVAPPPQ PNPQPAPNPQ PAPNPQPAPE PKPAPSAYYK       120
     NCAEARAAGA APLHAGEPGY RTGLDRDGDG VACE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page