(data stored in ACNUC7421 zone)

EMBL: CP001630.PE297

CP001630.PE297       Location/Qualifiers
FT   CDS             complement(329694..330653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0302"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: sal:Sala_0134
FT                   excalibur"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34271"
FT                   /db_xref="GOA:C6WGF5"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF5"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACU34271.1"
FT                   /translation="MSANHGNDQNGGAPGYGVPDDNAGYGTPGYGVPGYGAPDYGYGPQ
FT                   ATAYTPPPQAKSGLKGKWSAMSRMKKTGTVAGGIFVALILIGALGDPPPADSTRAAATA
FT                   SATATTTSTTTTTTTAPTTTTPPPVTVAEVADGRSVAVAGGRVLVLAGLAQPGECWAQQ
FT                   AVDFLKSTVAGKELAQVGGQLLLPDGSDVSLLALSQGVAKALPEASAAHNAAQAAAQKA
FT                   GLGLWGAPCGGSDAKPAPTTTTQAPAPQPNPQPNPQPQPNPQPNPQPAPQPEPQPAPSA
FT                   YYANCAAVKAAGAAPLYAGSPGYSSKLDRDGDGVACEK"
     MSANHGNDQN GGAPGYGVPD DNAGYGTPGY GVPGYGAPDY GYGPQATAYT PPPQAKSGLK        60
     GKWSAMSRMK KTGTVAGGIF VALILIGALG DPPPADSTRA AATASATATT TSTTTTTTTA       120
     PTTTTPPPVT VAEVADGRSV AVAGGRVLVL AGLAQPGECW AQQAVDFLKS TVAGKELAQV       180
     GGQLLLPDGS DVSLLALSQG VAKALPEASA AHNAAQAAAQ KAGLGLWGAP CGGSDAKPAP       240
     TTTTQAPAPQ PNPQPNPQPQ PNPQPNPQPA PQPEPQPAPS AYYANCAAVK AAGAAPLYAG       300
     SPGYSSKLDR DGDGVACEK                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page