(data stored in ACNUC7421 zone)

EMBL: CP001630.PE298

CP001630.PE298       Location/Qualifiers
FT   CDS             complement(330650..331321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0303"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein); KEGG: mno:Mnod_4939
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34272"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF6"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ACU34272.1"
FT                   /translation="MESTALVRRTPLRLLLLVPALLLTACAAQPLAAPAVPAPAAEDAA
FT                   PDAAERWDRSGAWSTPSPAQPDPADLAPARASGVVDARTIAVAGGGSVRLLGLAEPGAC
FT                   WSRAAADFLGSLVAQKDLALDGASVRLPGGTDLSAQLVSQGMARAEPDAASTLTRAEAA
FT                   ARKAGLGLWGAPCGGSDSVVTTPAPTTRALARCTANTSTTPAGLPGSPVLDHDTDGVAC
FT                   A"
     MESTALVRRT PLRLLLLVPA LLLTACAAQP LAAPAVPAPA AEDAAPDAAE RWDRSGAWST        60
     PSPAQPDPAD LAPARASGVV DARTIAVAGG GSVRLLGLAE PGACWSRAAA DFLGSLVAQK       120
     DLALDGASVR LPGGTDLSAQ LVSQGMARAE PDAASTLTRA EAAARKAGLG LWGAPCGGSD       180
     SVVTTPAPTT RALARCTANT STTPAGLPGS PVLDHDTDGV ACA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page