(data stored in ACNUC7421 zone)

EMBL: CP001630.PE299

CP001630.PE299       Location/Qualifiers
FT   CDS             complement(331443..331889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c1913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34273"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34273.1"
FT                   /translation="MDPSLVADAMRKSVPWVQTNGVEFTEVGVDRVVAALPDRPESRNH
FT                   VGGPHAAMLFGVGETASGAVVMAAFGGHLDRATPLVARAEIAYRKLALGPLTAEAVLER
FT                   PAADVVAELEGGQRPEFPVRVSVRDAEGVVTTELVVTWTLKPQR"
     MDPSLVADAM RKSVPWVQTN GVEFTEVGVD RVVAALPDRP ESRNHVGGPH AAMLFGVGET        60
     ASGAVVMAAF GGHLDRATPL VARAEIAYRK LALGPLTAEA VLERPAADVV AELEGGQRPE       120
     FPVRVSVRDA EGVVTTELVV TWTLKPQR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page