(data stored in ACNUC7421 zone)

EMBL: CP001630.PE3

CP001630.PE3         Location/Qualifiers
FT   CDS             3806..4720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; NADP oxidoreductase coenzyme F420-dependent; KEGG:
FT                   dde:Dde_3470 6-phosphogluconate dehydrogenase- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33977"
FT                   /db_xref="GOA:C6WCF6"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF6"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACU33977.1"
FT                   /translation="MQLGIVGLGKMGFNMRERVRRAGHEVVGYDRNPDVSDTTSLADLA
FT                   AKLTGPRVVWVMVPAGEITRNTVAELSEVLSEGDLVIDGGNSRFTDDALNAAKLAEKGI
FT                   GYLDCGVSGGVWGLENGYGLMVGGDAADVERAMPIFDALRPEGPREEGFAHAGKLGAGH
FT                   FAKMVHNGIEYGLMQAYAEGFELLEASELVENVPATIKAWQRGTVVRSWLLDLLVNALD
FT                   SDPELDDLRGYVEDSGEGRWTVEEAINHAVPAPVISAALFARFASRQSDSPAMRAVAAL
FT                   RNQFGGHAVQSAGPSSGSGSTQG"
     MQLGIVGLGK MGFNMRERVR RAGHEVVGYD RNPDVSDTTS LADLAAKLTG PRVVWVMVPA        60
     GEITRNTVAE LSEVLSEGDL VIDGGNSRFT DDALNAAKLA EKGIGYLDCG VSGGVWGLEN       120
     GYGLMVGGDA ADVERAMPIF DALRPEGPRE EGFAHAGKLG AGHFAKMVHN GIEYGLMQAY       180
     AEGFELLEAS ELVENVPATI KAWQRGTVVR SWLLDLLVNA LDSDPELDDL RGYVEDSGEG       240
     RWTVEEAINH AVPAPVISAA LFARFASRQS DSPAMRAVAA LRNQFGGHAV QSAGPSSGSG       300
     STQG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page