(data stored in ACNUC7421 zone)

EMBL: CP001630.PE30

CP001630.PE30        Location/Qualifiers
FT   CDS             complement(33316..34593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0030"
FT                   /product="FAD-linked oxidoreductase"
FT                   /EC_number="1.1.3.8"
FT                   /note="KEGG: bur:Bcep18194_B3008 FAD-linked oxidoreductase;
FT                   TIGRFAM: FAD-linked oxidoreductase; PFAM:
FT                   D-arabinono-14-lactone oxidase; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34004"
FT                   /db_xref="GOA:C6WCI3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI3"
FT                   /inference="protein motif:TFAM:TIGR01679"
FT                   /protein_id="ACU34004.1"
FT                   /translation="MAPPWTNWARTETAAPIRVEHPTTAEGISEVVRTADAVRARGSGH
FT                   SFTGVAVAPSVALDLDRWTGLVDVAGELVTVRAGTTLRQLNELLHREGLAMPNLGDIDA
FT                   QTIAGATATGTHGTGAALGGLATTIVALEVVLADGSLVRCSPTERPDLFEAARLGLGAV
FT                   GVISTLTLRCVPSFVLHAREYPARLDAVLEEFDHLTATEDHVEFHWFPHGDRVIVKRNN
FT                   RVDEPRAPLSGLRRFYEYDVMENAAFGAVCKVARAVPATARGLNRMCGALIGERDYRDQ
FT                   SHRVFTTPRRVRFVETEYAVPRAELHGVLRELRAAVAGLEHGVIVPVEVRVARGDDIWL
FT                   STAHGRDTAYVAVHQYVGMPHRRYFDAFERIALAVGGRPHWGKLHSLGAEELATRYPRF
FT                   ADFRRVRAEVDPDRKFGNRHLERVLG"
     MAPPWTNWAR TETAAPIRVE HPTTAEGISE VVRTADAVRA RGSGHSFTGV AVAPSVALDL        60
     DRWTGLVDVA GELVTVRAGT TLRQLNELLH REGLAMPNLG DIDAQTIAGA TATGTHGTGA       120
     ALGGLATTIV ALEVVLADGS LVRCSPTERP DLFEAARLGL GAVGVISTLT LRCVPSFVLH       180
     AREYPARLDA VLEEFDHLTA TEDHVEFHWF PHGDRVIVKR NNRVDEPRAP LSGLRRFYEY       240
     DVMENAAFGA VCKVARAVPA TARGLNRMCG ALIGERDYRD QSHRVFTTPR RVRFVETEYA       300
     VPRAELHGVL RELRAAVAGL EHGVIVPVEV RVARGDDIWL STAHGRDTAY VAVHQYVGMP       360
     HRRYFDAFER IALAVGGRPH WGKLHSLGAE ELATRYPRFA DFRRVRAEVD PDRKFGNRHL       420
     ERVLG                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page