(data stored in ACNUC7421 zone)

EMBL: CP001630.PE300

CP001630.PE300       Location/Qualifiers
FT   CDS             332019..332537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0305"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: atc:AGR_C_1531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34274"
FT                   /db_xref="GOA:C6WGF8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34274.1"
FT                   /translation="MTTPEDAHGGGRSDEALADRFGTALVRLNKMHAALSASLSKAGID
FT                   KASFVLLANLAQMGPSRASALAEAVFSDPSTVSRQVAGLVKDGLVERRADPDDGRASVL
FT                   AVTDNGLSLLHERRRVRNAALARLFSDWSTHDWTTFVEHFERFVEGYEKALPDFIAEGG
FT                   QGPRSEGEK"
     MTTPEDAHGG GRSDEALADR FGTALVRLNK MHAALSASLS KAGIDKASFV LLANLAQMGP        60
     SRASALAEAV FSDPSTVSRQ VAGLVKDGLV ERRADPDDGR ASVLAVTDNG LSLLHERRRV       120
     RNAALARLFS DWSTHDWTTF VEHFERFVEG YEKALPDFIA EGGQGPRSEG EK               172
//

If you have problems or comments...

PBIL Back to PBIL home page