(data stored in ACNUC7421 zone)

EMBL: CP001630.PE301

CP001630.PE301       Location/Qualifiers
FT   CDS             332537..334204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0306"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppg:PputGB1_3285 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34275"
FT                   /db_xref="GOA:C6WGF9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF9"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU34275.1"
FT                   /translation="MSETTTQAGATPPGAALLTHRQILTILSGLLMGMFLAALDQMIVA
FT                   TAMKTIADHLNGQTIQAWATTAYLITSTITTPLYGKLSDIYGRKPMYLTAISMFLVGSL
FT                   LCGIANSMYELAAFRAVQGLGAGGLMSLAFAILADITSPRERSRYAGYFMAVFGVASVA
FT                   GPVVGGLFAGMDHFLGFAGWRWVFLVNVPIALAALAVVAKVLNIPHQRVDHRVDFLGAI
FT                   TLTVGLVPLLIVAEQGREWGWGSATAIAMYVVGVLGLVAFVWAEKRAGDEALLPLRLFR
FT                   KQTFALGNTINFVLGAGMFGGMVSIPLYLQIVQGHSATTAGLMMLPMTLGIMTAAGTSG
FT                   KITSKTGRYKVFPVVGFAVMTASLFLFSTVGVDTATWQPMALMFTMGLGLGLCMQTLLI
FT                   AIQNDAEPRDMGVATSSATFFRQIGGTVGAAVFLSVLFSTVGDKIGEALRSAMGTDAFR
FT                   AALARPENQAFAQQLQSGGASADLNNTEFLSKLDPVLARPFLEGFSSAIDTVFFVGALV
FT                   TLVGFAIVWFLREVPLSDRSGLERSKDEADAASTIALH"
     MSETTTQAGA TPPGAALLTH RQILTILSGL LMGMFLAALD QMIVATAMKT IADHLNGQTI        60
     QAWATTAYLI TSTITTPLYG KLSDIYGRKP MYLTAISMFL VGSLLCGIAN SMYELAAFRA       120
     VQGLGAGGLM SLAFAILADI TSPRERSRYA GYFMAVFGVA SVAGPVVGGL FAGMDHFLGF       180
     AGWRWVFLVN VPIALAALAV VAKVLNIPHQ RVDHRVDFLG AITLTVGLVP LLIVAEQGRE       240
     WGWGSATAIA MYVVGVLGLV AFVWAEKRAG DEALLPLRLF RKQTFALGNT INFVLGAGMF       300
     GGMVSIPLYL QIVQGHSATT AGLMMLPMTL GIMTAAGTSG KITSKTGRYK VFPVVGFAVM       360
     TASLFLFSTV GVDTATWQPM ALMFTMGLGL GLCMQTLLIA IQNDAEPRDM GVATSSATFF       420
     RQIGGTVGAA VFLSVLFSTV GDKIGEALRS AMGTDAFRAA LARPENQAFA QQLQSGGASA       480
     DLNNTEFLSK LDPVLARPFL EGFSSAIDTV FFVGALVTLV GFAIVWFLRE VPLSDRSGLE       540
     RSKDEADAAS TIALH                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page