(data stored in ACNUC7421 zone)

EMBL: CP001630.PE302

CP001630.PE302       Location/Qualifiers
FT   CDS             complement(334313..334816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0307"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: gdi:GDI3491
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34276"
FT                   /db_xref="GOA:C6WGG0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG0"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACU34276.1"
FT                   /translation="MEFDVTIEIPKGVRNKYEMDHKTGRIRLDRTLFTATQYPADYGFV
FT                   DDTLGEDGDPLDALVLVQEPTFPGCLIRCRAIGMFRMTDEKGGDDKLLCVPSDDPRSEH
FT                   LRDIHHLSEFYRLEIQHFFEVYKDLEPGKSVEGATWVGRTEAEAEIVRSYQRLKDAVAR
FT                   GEEH"
     MEFDVTIEIP KGVRNKYEMD HKTGRIRLDR TLFTATQYPA DYGFVDDTLG EDGDPLDALV        60
     LVQEPTFPGC LIRCRAIGMF RMTDEKGGDD KLLCVPSDDP RSEHLRDIHH LSEFYRLEIQ       120
     HFFEVYKDLE PGKSVEGATW VGRTEAEAEI VRSYQRLKDA VARGEEH                     167
//

If you have problems or comments...

PBIL Back to PBIL home page