(data stored in ACNUC7421 zone)

EMBL: CP001630.PE303

CP001630.PE303       Location/Qualifiers
FT   CDS             334943..337993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0308"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine carboxypeptidase/D-
FT                   alanyl-D-alanine-endopeptidase; PFAM: peptidase S13
FT                   D-Ala-D-Ala carboxypeptidase C; KEGG: bpm:BURPS1710b_1102
FT                   putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34277"
FT                   /db_xref="GOA:C6WGG1"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG1"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACU34277.1"
FT                   /translation="MPEEPSWPTVDGDDTDREQVRSPRPADPPTMRIALPKKSGGAEKT
FT                   ELIKIDRLRPPGGPTPRTDLPEAGGESGADAAAAAQQPSGAQRGTAAEQGATPAGPDGD
FT                   EITRPAGASQAETARPGDEDNRSGGQAGAGGAGAGGAGAAALAAGAAALAAGAAGAQAS
FT                   GAQGGGAQSGGGQAGGGPAGGGKSGPQQSNAPQSGGGQQSGGQQTGDGQQTGGAPSGST
FT                   PPGGVPAPGMASGAPAGGFPAPGTPAGGFPAPGTPAGGFPAPGGLLGGEPTRFDPPKSA
FT                   PLPEAGWPGTRAEVPSFDPARADAQLAAQRAAANRAQNSGRPESGQQQAPGQQGPGQQA
FT                   GGQQAPGQQGAGQQSPGQQGAGQQGPHQQGIGQQGPGQQGPGHLGAGQQGPGNQAGGQQ
FT                   GPGRQGQGGHGSGPHGTIPPGAIPPGSGQAGAGTGGFGQQGPGRQGPGSQGIRHQGGQS
FT                   ASEQTQKVSVTPGQFTFPPPGQQPGGEQHRAAPPGTIPPGANQSGTIPPGANQSGTIPP
FT                   GANQPGVADHPGSSADRRDDDAAFAAFAADSDERADVPAQRSKRKRPLVVVGALAAVLV
FT                   LFGGAALAAVQLGWLETGPTSTTQPPAPPAQVDLAVRALGPDAPAPTPAGVQAVLQGPL
FT                   ANGALGNLTGTVIDPASKTVLWHQGETTPLVPASTVKNLVAAAALLQLDHTTQFTTKVV
FT                   QGAEPGTVVLVGGGDPTLSSLPEGRSSVYPGAPTLDELVEQVKASGPITEVEYDISRYS
FT                   AEPGLAPGVDPNDVAAGFITNIGPLMLDGARSDPTKGDTPRTATPAPDAAKALADRLGA
FT                   TVGGKTLAPQAAKVLGEVKSVPLDQLIENMMQLSDNVLAETLAREVAKARNAETSYEGA
FT                   TKAVRDVLTENGFDLTGVITSDASGMSVQNKVPAKLLGDLLTAAARPDAATDPVTTRLR
FT                   PLLTALAVAGGNGTLKERFAQSPAGKGWIRGKTGTLTEVHSLAGVVVDTDGRLLVFAFM
FT                   SNGSGDALGARAGLDALAAQLRGCGCS"
     MPEEPSWPTV DGDDTDREQV RSPRPADPPT MRIALPKKSG GAEKTELIKI DRLRPPGGPT        60
     PRTDLPEAGG ESGADAAAAA QQPSGAQRGT AAEQGATPAG PDGDEITRPA GASQAETARP       120
     GDEDNRSGGQ AGAGGAGAGG AGAAALAAGA AALAAGAAGA QASGAQGGGA QSGGGQAGGG       180
     PAGGGKSGPQ QSNAPQSGGG QQSGGQQTGD GQQTGGAPSG STPPGGVPAP GMASGAPAGG       240
     FPAPGTPAGG FPAPGTPAGG FPAPGGLLGG EPTRFDPPKS APLPEAGWPG TRAEVPSFDP       300
     ARADAQLAAQ RAAANRAQNS GRPESGQQQA PGQQGPGQQA GGQQAPGQQG AGQQSPGQQG       360
     AGQQGPHQQG IGQQGPGQQG PGHLGAGQQG PGNQAGGQQG PGRQGQGGHG SGPHGTIPPG       420
     AIPPGSGQAG AGTGGFGQQG PGRQGPGSQG IRHQGGQSAS EQTQKVSVTP GQFTFPPPGQ       480
     QPGGEQHRAA PPGTIPPGAN QSGTIPPGAN QSGTIPPGAN QPGVADHPGS SADRRDDDAA       540
     FAAFAADSDE RADVPAQRSK RKRPLVVVGA LAAVLVLFGG AALAAVQLGW LETGPTSTTQ       600
     PPAPPAQVDL AVRALGPDAP APTPAGVQAV LQGPLANGAL GNLTGTVIDP ASKTVLWHQG       660
     ETTPLVPAST VKNLVAAAAL LQLDHTTQFT TKVVQGAEPG TVVLVGGGDP TLSSLPEGRS       720
     SVYPGAPTLD ELVEQVKASG PITEVEYDIS RYSAEPGLAP GVDPNDVAAG FITNIGPLML       780
     DGARSDPTKG DTPRTATPAP DAAKALADRL GATVGGKTLA PQAAKVLGEV KSVPLDQLIE       840
     NMMQLSDNVL AETLAREVAK ARNAETSYEG ATKAVRDVLT ENGFDLTGVI TSDASGMSVQ       900
     NKVPAKLLGD LLTAAARPDA ATDPVTTRLR PLLTALAVAG GNGTLKERFA QSPAGKGWIR       960
     GKTGTLTEVH SLAGVVVDTD GRLLVFAFMS NGSGDALGAR AGLDALAAQL RGCGCS          1016
//

If you have problems or comments...

PBIL Back to PBIL home page