(data stored in ACNUC7421 zone)

EMBL: CP001630.PE304

CP001630.PE304       Location/Qualifiers
FT   CDS             338032..339045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34278"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG2"
FT                   /inference="protein motif:COG:COG5282"
FT                   /protein_id="ACU34278.1"
FT                   /translation="MTQQDRAASIDWEVAVSTAARLVRPGPVVPRAEADVAVGRLRELA
FT                   VDAEAHVRELTGLGHGLPLRAGEVVDRPGWVRAAAQGLSVLTDSAAPRQGGVLSGVVSG
FT                   TAGVQAGVVLAFLSSRVLGQYDPFSGDGRLLLVAPNIVGTQRALNVPGEDFSMWVCLHE
FT                   CTHRLQFTGVPWLAGHFSGLVTELLESMDNESPRLRDLPKRLREADGPVGLIELFQTPE
FT                   QRAALDRLIAVSTLLEGHADHVMDAVGPDVVPSVAVIRRRFTDRRSGGGLLDRVLRSLL
FT                   GVEAKVRQYAEGAAFTRHVVDEVGMTGFNAVWSAPEALPTRAEIADPAAWLRRVAP"
     MTQQDRAASI DWEVAVSTAA RLVRPGPVVP RAEADVAVGR LRELAVDAEA HVRELTGLGH        60
     GLPLRAGEVV DRPGWVRAAA QGLSVLTDSA APRQGGVLSG VVSGTAGVQA GVVLAFLSSR       120
     VLGQYDPFSG DGRLLLVAPN IVGTQRALNV PGEDFSMWVC LHECTHRLQF TGVPWLAGHF       180
     SGLVTELLES MDNESPRLRD LPKRLREADG PVGLIELFQT PEQRAALDRL IAVSTLLEGH       240
     ADHVMDAVGP DVVPSVAVIR RRFTDRRSGG GLLDRVLRSL LGVEAKVRQY AEGAAFTRHV       300
     VDEVGMTGFN AVWSAPEALP TRAEIADPAA WLRRVAP                                337
//

If you have problems or comments...

PBIL Back to PBIL home page