(data stored in ACNUC7421 zone)

EMBL: CP001630.PE305

CP001630.PE305       Location/Qualifiers
FT   CDS             339042..339968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0310"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: ade:Adeh_1494
FT                   tRNA(Ile)-lysidine synthetase- like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34279"
FT                   /db_xref="GOA:C6WGG3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG3"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACU34279.1"
FT                   /translation="MTPAANGPLSRVRTAVRRFLAEHRPARVAVAVSGGADSLALAACT
FT                   AALTSGARAVVVDHGLQEGSAEVAERAARTCAELGLDAQVRRVEVTGGGGPEAAARRAR
FT                   YAALRPERGLVLLGHTLDDQAETVLLGLGRGSGPRSIAGMRELDAPWGRPLLGVSRADT
FT                   EGACAELGLSPWSDPHNADPAFTRVRLRREVLPLLEEVLQGGVARALARTAAQLREDND
FT                   ALDDLADAFAGDRGAVADLAPLPVALRRRVLRRWLLAEGVPELSDSHLRAVDALVRTGA
FT                   GGGGVWVPGGFVVRRARGRLRVDPVQA"
     MTPAANGPLS RVRTAVRRFL AEHRPARVAV AVSGGADSLA LAACTAALTS GARAVVVDHG        60
     LQEGSAEVAE RAARTCAELG LDAQVRRVEV TGGGGPEAAA RRARYAALRP ERGLVLLGHT       120
     LDDQAETVLL GLGRGSGPRS IAGMRELDAP WGRPLLGVSR ADTEGACAEL GLSPWSDPHN       180
     ADPAFTRVRL RREVLPLLEE VLQGGVARAL ARTAAQLRED NDALDDLADA FAGDRGAVAD       240
     LAPLPVALRR RVLRRWLLAE GVPELSDSHL RAVDALVRTG AGGGGVWVPG GFVVRRARGR       300
     LRVDPVQA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page