(data stored in ACNUC7421 zone)

EMBL: CP001630.PE306

CP001630.PE306       Location/Qualifiers
FT   CDS             339985..340533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0311"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: spe:Spro_3998 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34280"
FT                   /db_xref="GOA:C6WGG4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG4"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACU34280.1"
FT                   /translation="MYDGDIASVLLSEQEISDKVGELARQVAADYPAGGDDLVLITVLK
FT                   GAVMFTSDLARALPVPVQLEFMAVSSYGSSTSSSGVVRILKDLDRDIADRDVLIVEDII
FT                   DSGLTLSWLLKNLASRKPRSMEVCTLLRKPDAVKVDVPVKYVGFDIPNEFVVGYGLDYA
FT                   ERYRDLPYIGKLDPKVYSG"
     MYDGDIASVL LSEQEISDKV GELARQVAAD YPAGGDDLVL ITVLKGAVMF TSDLARALPV        60
     PVQLEFMAVS SYGSSTSSSG VVRILKDLDR DIADRDVLIV EDIIDSGLTL SWLLKNLASR       120
     KPRSMEVCTL LRKPDAVKVD VPVKYVGFDI PNEFVVGYGL DYAERYRDLP YIGKLDPKVY       180
     SG                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page