(data stored in ACNUC7421 zone)

EMBL: CP001630.PE307

CP001630.PE307       Location/Qualifiers
FT   CDS             complement(340597..342291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0312"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: dac:Daci_0766 von
FT                   Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34281"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG5"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACU34281.1"
FT                   /translation="MSARSERPGRARRIALPLGALVGVLAAGATAVVALKATSGPDCTG
FT                   TLPLKVATTPAAEAVVRGAADDYQATQPVVDGRCVQVQVEARTAADVAHELPTARINPP
FT                   VMWVPDSTMWAEEAQRQSASLGAEAPALEVGEPLAGSPLVIAGPAEKLRGLGWPSTSVA
FT                   WASVLAPGVEAAVSDPTTSTEGLATLAVIRARLGNADGTPNQELIGSLMRIGRNAVTVR
FT                   DSFNRVGQDEGSAPLFTASEQAVLAANRAAGGLRVAASYPAEGTMLLDYPVVRIKRASD
FT                   QPGTGVAASGFEQALRSAKTRERFVDAGFRTPDGQAAAGLSAERDGVGGDAVNAMPKPS
FT                   PAEVSELLGTWGAVSLDSRMLAVLDVSGSMTELMGNGQTRMAAASEAALTALGMLPDTS
FT                   EIGLWAFSTNKRPPNDWVELVPLGPLGEVLGSAPRRTRLQQGAKGLAALVGGGTALNDT
FT                   TLAAFRRMQSTYDPEKINSVVLITDGRNDDYASITTAQLLQALESESDPARPIPLIMVG
FT                   LGQEADMEALQEISSATGGKAYQALEAADIRSVLLDAISQRRCRPNC"
     MSARSERPGR ARRIALPLGA LVGVLAAGAT AVVALKATSG PDCTGTLPLK VATTPAAEAV        60
     VRGAADDYQA TQPVVDGRCV QVQVEARTAA DVAHELPTAR INPPVMWVPD STMWAEEAQR       120
     QSASLGAEAP ALEVGEPLAG SPLVIAGPAE KLRGLGWPST SVAWASVLAP GVEAAVSDPT       180
     TSTEGLATLA VIRARLGNAD GTPNQELIGS LMRIGRNAVT VRDSFNRVGQ DEGSAPLFTA       240
     SEQAVLAANR AAGGLRVAAS YPAEGTMLLD YPVVRIKRAS DQPGTGVAAS GFEQALRSAK       300
     TRERFVDAGF RTPDGQAAAG LSAERDGVGG DAVNAMPKPS PAEVSELLGT WGAVSLDSRM       360
     LAVLDVSGSM TELMGNGQTR MAAASEAALT ALGMLPDTSE IGLWAFSTNK RPPNDWVELV       420
     PLGPLGEVLG SAPRRTRLQQ GAKGLAALVG GGTALNDTTL AAFRRMQSTY DPEKINSVVL       480
     ITDGRNDDYA SITTAQLLQA LESESDPARP IPLIMVGLGQ EADMEALQEI SSATGGKAYQ       540
     ALEAADIRSV LLDAISQRRC RPNC                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page