(data stored in ACNUC7421 zone)

EMBL: CP001630.PE308

CP001630.PE308       Location/Qualifiers
FT   CDS             342757..344988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0313"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: bcy:Bcer98_0060 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; peptidase M41 FtsH extracellular; AAA ATPase
FT                   central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34282"
FT                   /db_xref="GOA:C6WGG6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG6"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACU34282.1"
FT                   /translation="MDRKRLLRNPLLWIVAVVLLFYVFSVLFDEDRNYHQVTTSQALQQ
FT                   VRDGKVKEATIEDKEQKLKLVLNDGSTFENHGLLMASYPASATDEVFTLVDQAGNKPQV
FT                   ETKVTQDSLLTQMLLYLVPLGLLLLLLMWMMNNAQGGGNRVLNFGKSKAKQLSKDMPKT
FT                   TFADVAGAEEAVEELYEIKDFLQNPGRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGE
FT                   AGVPFYSISGSDFVEMFVGVGASRVRDLFEQAKQNAPCIIFVDEIDAVGRHRGAGMGGG
FT                   HDEREQTLNQLLVEMDGFDSRGGIILIAATNRPDILDPALLRPGRFDRQIPVSAPDLKG
FT                   RKQILRVHAKGKPLAPDTDLDGLAKRTVGFSGADLANVINEAALLTARQNGTVIDGSAL
FT                   EESVDRVIGGPARKSRIISEKEKKITAYHEAGHALAAWAMPDIDPVYKVTILARGRTGG
FT                   HTLSVPEEDKDLMTRSEMIARLVFALGGRSAEELVFHEPTTGASNDIEQATKIARAMVT
FT                   EYGMSSRLGAVKYGQEQGEPFLGRNAGRQADYSLEVAHEIDEEVRKLIEAAHTEAYEVL
FT                   NTYRDVLDDLTLELIDKETLHQKDLERIFAGVEKRPRITQFNDFGNRIPSTKPPVKTPG
FT                   ELARERGEPWPPVVEDQVEAEPAALPAPAPETPQGPAQPQQVPAGANGVQHPPQQVTPG
FT                   SGPPNYGAPPGWTPATVPGSGGQPTTPAWRPDPADADKRNFDSDPDNRK"
     MDRKRLLRNP LLWIVAVVLL FYVFSVLFDE DRNYHQVTTS QALQQVRDGK VKEATIEDKE        60
     QKLKLVLNDG STFENHGLLM ASYPASATDE VFTLVDQAGN KPQVETKVTQ DSLLTQMLLY       120
     LVPLGLLLLL LMWMMNNAQG GGNRVLNFGK SKAKQLSKDM PKTTFADVAG AEEAVEELYE       180
     IKDFLQNPGR YQALGAKIPK GVLLYGPPGT GKTLLARAVA GEAGVPFYSI SGSDFVEMFV       240
     GVGASRVRDL FEQAKQNAPC IIFVDEIDAV GRHRGAGMGG GHDEREQTLN QLLVEMDGFD       300
     SRGGIILIAA TNRPDILDPA LLRPGRFDRQ IPVSAPDLKG RKQILRVHAK GKPLAPDTDL       360
     DGLAKRTVGF SGADLANVIN EAALLTARQN GTVIDGSALE ESVDRVIGGP ARKSRIISEK       420
     EKKITAYHEA GHALAAWAMP DIDPVYKVTI LARGRTGGHT LSVPEEDKDL MTRSEMIARL       480
     VFALGGRSAE ELVFHEPTTG ASNDIEQATK IARAMVTEYG MSSRLGAVKY GQEQGEPFLG       540
     RNAGRQADYS LEVAHEIDEE VRKLIEAAHT EAYEVLNTYR DVLDDLTLEL IDKETLHQKD       600
     LERIFAGVEK RPRITQFNDF GNRIPSTKPP VKTPGELARE RGEPWPPVVE DQVEAEPAAL       660
     PAPAPETPQG PAQPQQVPAG ANGVQHPPQQ VTPGSGPPNY GAPPGWTPAT VPGSGGQPTT       720
     PAWRPDPADA DKRNFDSDPD NRK                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page