(data stored in ACNUC7421 zone)

EMBL: CP001630.PE309

CP001630.PE309       Location/Qualifiers
FT   CDS             344985..345614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0314"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: bha:BH1646 GTP cyclohydrolase I; TIGRFAM: GTP
FT                   cyclohydrolase I; PFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34283"
FT                   /db_xref="GOA:C6WGG7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG7"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ACU34283.1"
FT                   /translation="MIEFDNAGLPSNGEAGVAAKRPFDQERAEAAVRELLLACGEDPER
FT                   EGLRETPARVARAYREMFAGLFTEPDGVLAKTFDESHEELVLVTEIPVYSFCEHHLLPF
FT                   HGVAHVGYIPNEQGRVTGLSKLARLVDLYAKRPQVQERLTSQVADALVRRLEPRGVIVV
FT                   VEAEHLCMGMRGVRKPGSRTTTSAVRGLLRTSASSRAEAISLIKGR"
     MIEFDNAGLP SNGEAGVAAK RPFDQERAEA AVRELLLACG EDPEREGLRE TPARVARAYR        60
     EMFAGLFTEP DGVLAKTFDE SHEELVLVTE IPVYSFCEHH LLPFHGVAHV GYIPNEQGRV       120
     TGLSKLARLV DLYAKRPQVQ ERLTSQVADA LVRRLEPRGV IVVVEAEHLC MGMRGVRKPG       180
     SRTTTSAVRG LLRTSASSRA EAISLIKGR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page