(data stored in ACNUC7421 zone)

EMBL: CP001630.PE31

CP001630.PE31        Location/Qualifiers
FT   CDS             34677..35864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0031"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bur:Bcep18194_B3007 amino acid aldolase or racemase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34005"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI4"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACU34005.1"
FT                   /translation="MQPRTRLDLATKDLEAPLAIVDLDAFDHNAADLVRRAGGKPIRVA
FT                   SKSVRVRALLDRVLARPGYAGLMCYSLPEALWLSSCDTAEDLLVAYPTVDHAALRALAA
FT                   DKKARGRVTIMVDSTAHLDLVDAALGEDHPEIRVCLELDVSWRPLPGLHVGPRRSPVHT
FT                   EGDAVRLARAVVARKGFRLVGVMAYEGQVAGIGDAPAGRRAWGLAVRWMQGRSVPELTE
FT                   RRAAAVAAVRRVADLEFVNGGGTGSLETTGADRSVTELAAGSGLVGPTLFDAYRAFSPR
FT                   PAALFALPVVRRPKKNVATLFAGGYVASGTGTPDRLPSPHLPSGLELIGLEGAGEVQTP
FT                   VVGKAADRLELGDRVWLRHAKAGELAERFAEYHLVSGDRVEAVVPTYRGEGKAFG"
     MQPRTRLDLA TKDLEAPLAI VDLDAFDHNA ADLVRRAGGK PIRVASKSVR VRALLDRVLA        60
     RPGYAGLMCY SLPEALWLSS CDTAEDLLVA YPTVDHAALR ALAADKKARG RVTIMVDSTA       120
     HLDLVDAALG EDHPEIRVCL ELDVSWRPLP GLHVGPRRSP VHTEGDAVRL ARAVVARKGF       180
     RLVGVMAYEG QVAGIGDAPA GRRAWGLAVR WMQGRSVPEL TERRAAAVAA VRRVADLEFV       240
     NGGGTGSLET TGADRSVTEL AAGSGLVGPT LFDAYRAFSP RPAALFALPV VRRPKKNVAT       300
     LFAGGYVASG TGTPDRLPSP HLPSGLELIG LEGAGEVQTP VVGKAADRLE LGDRVWLRHA       360
     KAGELAERFA EYHLVSGDRV EAVVPTYRGE GKAFG                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page