(data stored in ACNUC7421 zone)

EMBL: CP001630.PE310

CP001630.PE310       Location/Qualifiers
FT   CDS             345653..346438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0315"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: afw:Anae109_2337 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34284"
FT                   /db_xref="GOA:C6WGG8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG8"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACU34284.1"
FT                   /translation="MGVLNVTADSFSDGGRYLGLADAVAHGLALRDQGAHLVDVGGEST
FT                   RPGAERVPSDLEVARTSHVIAALSAQGVVTSVDTTRSEVAVAALEAGVSVVNDVSGGLA
FT                   DPDMLRVVAEADVPYVVMHWRGHSAGMDRLAEYSDVVREVRDELSARVDAALAAGVRAE
FT                   NVVVDPGLGFAKRAEHNWQLLNRLDELIDLGFPVLVGASRKRFLGALLGERPPAGREDA
FT                   TAAVSALAAFNGAWGVRVHDVPRSVDAVAVAGAWRAGRG"
     MGVLNVTADS FSDGGRYLGL ADAVAHGLAL RDQGAHLVDV GGESTRPGAE RVPSDLEVAR        60
     TSHVIAALSA QGVVTSVDTT RSEVAVAALE AGVSVVNDVS GGLADPDMLR VVAEADVPYV       120
     VMHWRGHSAG MDRLAEYSDV VREVRDELSA RVDAALAAGV RAENVVVDPG LGFAKRAEHN       180
     WQLLNRLDEL IDLGFPVLVG ASRKRFLGAL LGERPPAGRE DATAAVSALA AFNGAWGVRV       240
     HDVPRSVDAV AVAGAWRAGR G                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page