(data stored in ACNUC7421 zone)

EMBL: CP001630.PE311

CP001630.PE311       Location/Qualifiers
FT   CDS             346431..346808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0316"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: oca:OCAR_6643
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34285"
FT                   /db_xref="GOA:C6WGG9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG9"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACU34285.1"
FT                   /translation="MAEATGSGDRIELRGLTVRAHHGVFEHEKRDGQDFLVDVVVWLDL
FT                   TRAAATDDLRETLHYGELAERVAEVVAGGPHDLIETVAGRAADVVMADGRVTATEVTVH
FT                   KPHAPIPLIFADVAVTVRRTR"
     MAEATGSGDR IELRGLTVRA HHGVFEHEKR DGQDFLVDVV VWLDLTRAAA TDDLRETLHY        60
     GELAERVAEV VAGGPHDLIE TVAGRAADVV MADGRVTATE VTVHKPHAPI PLIFADVAVT       120
     VRRTR                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page